Entry information : BdiPrx17 (Bradi1g26870)
Entry ID 7835
Creation 2011-01-12 (Toky Ramarohetra)
Last sequence changes 2011-01-12 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-16 (Qiang Li)
Peroxidase information: BdiPrx17 (Bradi1g26870)
Name (synonym) BdiPrx17 (Bradi1g26870)
Class Class III peroxidase    [Orthogroup: Prx038]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx17
start..stop
S start..stop
OsPrx102 388 2e-135 34..347 32..345
SiPrx118 382 5e-133 3..348 1..357
ZmPrx73 369 6e-128 3..348 1..364
SbPrx33 360 2e-124 50..348 53..361
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 21946211..21946519 309 N° 2 21945777..21946122 346 N° 3 21945298..21945689 392  
complement(join(21945298..21945689,21945777..21946122,21946211..21946519))


exon

Literature and cross-references BdiPrx17 (Bradi1g26870)
DNA ref. Phytozome 12:   Bd1 (21946519..21945298)
Protein sequence: BdiPrx17 (Bradi1g26870)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   348 (326)
PWM (Da):   %s   38735.32 (36285.0)  
PI (pH):   %s   7.44 (6.63) Peptide Signal:   %s   cut: 23 range:23-348
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRMRMPRSSVLSFLAVSAFVLAASVTADNYDKGGQQQQNKEACDDQYDRAYHKPAAGLVSEYYGKSCPDMERIVQAAVNRAIANDYTVAAGLIRLFFHDFAVRGCDGSILIDAPGSERHAAASKTLRGFELIEEIKAKLNARCNNTVSCADILTAATRDASMKVGVPYWSLKYGRKDGRDSHAEEADAQVPMGRERVTDLVQFFETRGLNVLDLVILSGAHTIGKASCGAVKRRVLTSKPETLDRKYGDFLLRKCHRGDDAERVELDGESPTTFDNRYYQNLERRMGLLETDQGMLEDSRTTRFVKEMAREPEVFKRQFAHSMRQLGEVNVLTGDEGEVRYKCSAVNY

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, intron 1 and 3), no EST. Missing 'c'. containing motif fhdf.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGATGAGGATGCCCCGGTCTTCGGTTCTCTCCTTCCTCGCCGTCTCGGCGTTCGTTCTCGCTGCGTCGGTGACCGCGGACAACTACGACAAGGGCGGCCAGCAGCAGCAGAACAAG
GAAGCCTGCGATGATCAGTACGACCGTGCCTACCACAAGCCCGCGGCCGGCCTCGTGTCCGAGTACTACGGCAAGTCGTGCCCGGACATGGAGCGCATCGTCCAGGCCGCCGTGAACCGG
GCCATCGCCAACGACTACACCGTCGCCGCCGGCCTCATCCGCCTATTCTTCCACGACTTCGCCGTCCGA
GTACGCAAATCAACGCACATTACATTACATTACACGATTCCTCTCTGTATA
CAAACTTGATTGATTTTGCTTTTGTTGTATGATCTAGGGGTGCGACGGGTCGATCCTGATCGACGCGCCGGGCAGCGAGAGGCACGCGGCGGCGAGCAAGACGCTCCGGGGCTTCGAGCT
GATCGAGGAGATCAAGGCCAAGCTCAACGCGCGCTGCAACAACACCGTGTCCTGCGCCGACATCCTCACGGCCGCCACCCGCGACGCCAGCATGAAGGTGGGCGTGCCCTACTGGTCGCT
CAAGTACGGCCGGAAGGACGGCCGCGACTCCCACGCCGAGGAGGCCGACGCGCAGGTTCCCATGGGCCGCGAGAGAGTCACCGACCTCGTCCAGTTCTTCGAGACCAGGGGCCTCAACGT
CCTCGACCTCGTCATCCTCTCCG
GTACGAATTCGATTCGAGCAGCAGGGCCTTTGTTTTGACAATGCACGGGAGGTGTTTGAGACAATGCGCGAACGCTTGATTATGCAGGGGCGCACAC
GATCGGGAAGGCGAGCTGCGGGGCGGTGAAGCGGCGGGTGTTGACCAGCAAGCCGGAGACGCTGGACCGGAAGTACGGCGACTTCCTGCTCCGCAAGTGCCACCGCGGAGACGATGCGGA
GCGCGTGGAGCTGGACGGCGAGTCGCCGACGACGTTCGACAACAGGTACTACCAGAACCTGGAGCGCAGGATGGGGCTCCTGGAGACGGACCAGGGGATGCTCGAGGACTCCCGGACGAC
GAGGTTCGTCAAGGAGATGGCCAGGGAGCCCGAGGTGTTCAAGCGCCAGTTCGCGCACTCCATGCGCCAGCTCGGCGAGGTCAACGTGCTTACTGGGGACGAGGGCGAGGTCCGCTACAA
GTGCTCCGCCGTCAACTACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGATGAGGATGCCCCGGTCTTCGGTTCTCTCCTTCCTCGCCGTCTCGGCGTTCGTTCTCGCTGCGTCGGTGACCGCGGACAACTACGACAAGGGCGGCCAGCAGCAGCAGAACAAG
GAAGCCTGCGATGATCAGTACGACCGTGCCTACCACAAGCCCGCGGCCGGCCTCGTGTCCGAGTACTACGGCAAGTCGTGCCCGGACATGGAGCGCATCGTCCAGGCCGCCGTGAACCGG
GCCATCGCCAACGACTACACCGTCGCCGCCGGCCTCATCCGCCTATTCTTCCACGACTTCGCCGTCCGA
GGGTGCGACGGGTCGATCCTGATCGACGCGCCGGGCAGCGAGAGGCACGCG
GCGGCGAGCAAGACGCTCCGGGGCTTCGAGCTGATCGAGGAGATCAAGGCCAAGCTCAACGCGCGCTGCAACAACACCGTGTCCTGCGCCGACATCCTCACGGCCGCCACCCGCGACGCC
AGCATGAAGGTGGGCGTGCCCTACTGGTCGCTCAAGTACGGCCGGAAGGACGGCCGCGACTCCCACGCCGAGGAGGCCGACGCGCAGGTTCCCATGGGCCGCGAGAGAGTCACCGACCTC
GTCCAGTTCTTCGAGACCAGGGGCCTCAACGTCCTCGACCTCGTCATCCTCTCCG
GGGCGCACACGATCGGGAAGGCGAGCTGCGGGGCGGTGAAGCGGCGGGTGTTGACCAGCAAGCCG
GAGACGCTGGACCGGAAGTACGGCGACTTCCTGCTCCGCAAGTGCCACCGCGGAGACGATGCGGAGCGCGTGGAGCTGGACGGCGAGTCGCCGACGACGTTCGACAACAGGTACTACCAG
AACCTGGAGCGCAGGATGGGGCTCCTGGAGACGGACCAGGGGATGCTCGAGGACTCCCGGACGACGAGGTTCGTCAAGGAGATGGCCAGGGAGCCCGAGGTGTTCAAGCGCCAGTTCGCG
CACTCCATGCGCCAGCTCGGCGAGGTCAACGTGCTTACTGGGGACGAGGGCGAGGTCCGCTACAAGTGCTCCGCCGTCAACTACTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGATGA GGATGCCCCG GTCTTCGGTT CTCTCCTTCC TCGCCGTCTC GGCGTTCGTT CTCGCTGCGT CGGTGACCGC GGACAACTAC GACAAGGGCG GCCAGCAGCA GCAGAACAAG  GAAGCCTGCG ATGATCAGTA CGACCGTGCC TACCACAAGC CCGCGGCCGG CCTCGTGTCC GAGTACTACG GCAAGTCGTG CCCGGACATG GAGCGCATCG TCCAGGCCGC CGTGAACCGG  GCCATCGCCA ACGACTACAC CGTCGCCGCC GGCCTCATCC GCCTATTCTT CCACGACTTC GCCGTCCGAG GGTGCGACGG GTCGATCCTG ATCGACGCGC CGGGCAGCGA GAGGCACGCG  GCGGCGAGCA AGACGCTCCG GGGCTTCGAG CTGATCGAGG AGATCAAGGC CAAGCTCAAC GCGCGCTGCA ACAACACCGT GTCCTGCGCC GACATCCTCA CGGCCGCCAC CCGCGACGCC  AGCATGAAGG TGGGCGTGCC CTACTGGTCG CTCAAGTACG GCCGGAAGGA CGGCCGCGAC TCCCACGCCG AGGAGGCCGA CGCGCAGGTT CCCATGGGCC GCGAGAGAGT CACCGACCTC  GTCCAGTTCT TCGAGACCAG GGGCCTCAAC GTCCTCGACC TCGTCATCCT CTCCGGGGCG CACACGATCG GGAAGGCGAG CTGCGGGGCG GTGAAGCGGC GGGTGTTGAC CAGCAAGCCG  GAGACGCTGG ACCGGAAGTA CGGCGACTTC CTGCTCCGCA AGTGCCACCG CGGAGACGAT GCGGAGCGCG TGGAGCTGGA CGGCGAGTCG CCGACGACGT TCGACAACAG GTACTACCAG  AACCTGGAGC GCAGGATGGG GCTCCTGGAG ACGGACCAGG GGATGCTCGA GGACTCCCGG ACGACGAGGT TCGTCAAGGA GATGGCCAGG GAGCCCGAGG TGTTCAAGCG CCAGTTCGCG  CACTCCATGC GCCAGCTCGG CGAGGTCAAC GTGCTTACTG GGGACGAGGG CGAGGTCCGC TACAAGTGCT CCGCCGTCAA CTACTGATCT CGTACCTACA GTATACAATT GAACAGTTGA  GCAAAGAACG ACCCATTGTG TACTGCGTGC TACTTCGCTC CATCGGTTCT CGATCGTGTA TACCGTTTCG GTTGATTTCT TGGTTCCAGG AAGAGGGAAA TGATATTTTT GTGTTTTGGG 
GTTTAAATCA CTTTTGTTTC GGTTAATCTT TCAGCTGTAT TTGTGGTGTA AAGTGTCTAT CAGATTTCCA CGCG 

Retrieve as FASTA