Entry information : BdiPrx18 (Bradi1g27910)
Entry ID 7836
Creation 2011-01-12 (Toky Ramarohetra)
Last sequence changes 2011-01-12 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx18 (Bradi1g27910)
Name (synonym) BdiPrx18 (Bradi1g27910)
Class Class III peroxidase    [Orthogroup: Prx023]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx18
start..stop
S start..stop
TaPrx16 492 4e-177 1..329 1..330
OsPrx126 471 6e-169 1..328 1..326
SiPrx159 466 5e-167 1..329 1..327
SbPrx06 455 2e-162 1..328 1..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 23086027..23086260 234 N° 2 23086360..23086542 183 N° 3 23086654..23086819 166 N° 4 23087085..23087491 407
join(23086027..23086260,23086360..23086542,23086654..23086819,23087085..23087491 )


exon

Literature and cross-references BdiPrx18 (Bradi1g27910)
DNA ref. Phytozome 12:   Bd1 (23086027..23087491)
Protein sequence: BdiPrx18 (Bradi1g27910)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (303)
PWM (Da):   %s   35214.28 (32374.9)  
PI (pH):   %s   4.8 (4.61) Peptide Signal:   %s   cut: 27 range:27-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEYSHSRLLLVCSVLMLCLCSGVAKCDKLTSELTGDFYDYTCPGLYTIVQQHVFAAMRDEMRMGASLLRLHFHDCFVNGCDASILLVGETGEQFARPNQNSVRGYEVIDAMKADIESVCPGVVSCADIVALAAAYGVLFSGGPYYEVLLGRKDGLVANKTGAENGLPAPFEPVSSIVQKFGDVGLDTKDVVVLSGAHTIGRARCGLFNNRLTSSGDPTLDSKMAANLQSLCTTGGDNQTTALDVESADVFDKQYYQNLLSKKGLLSSDQNLFSGAEDVVKATTKALVQTYSDDGEQFFMDFGASMVKMGSIKKTGVPGEIRTNCRVPNK

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, intron 1, 2 and 3), no EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGTACTCTCACAGCAGGTTGCTCCTTGTATGCTCAGTTCTTATGCTGTGCCTCTGCAGTGGAGTCGCAAAGTGCGATAAGTTAACCAGTGAGCTAACGGGCGATTTCTATGACTAC
ACATGCCCCGGTTTGTATACCATCGTCCAGCAGCATGTGTTTGCTGCCATGAGGGATGAGATGAGGATGGGAGCTTCCCTGCTCAGGCTCCATTTCCATGATTGCTTTGTCAAT
GTAACT
TAAACATCCTCTGAACTTAACTCTGAATGTTTGTTGTACATCTACAGTTGCGTTGAAGTTCAGTGATAACTTTTTGTGTCGTGATGTGTTCAGGGGTGTGATGCTTCGATCCTGTTGGTT
GGCGAAACTGGCGAGCAATTTGCGCGTCCCAACCAGAACTCTGTCAGAGGGTACGAGGTCATCGACGCGATGAAGGCCGATATTGAGAGTGTTTGTCCTGGGGTGGTGTCATGTGCTGAC
ATTGTAGCCCTTGCAGCTGCCTATGGAGTACTCTTT
GTGAGCATTCTTACATCTTATAGTCCATTTTCTTCAGATATATTCAGCCTGTCAGACAAAGTACTAGCTCTGGAAATTTAATTT
GCTTATGACATGTGTTGACTTGGTCAGAGTGGAGGGCCATACTATGAAGTTCTTCTGGGTAGAAAGGACGGCCTGGTAGCAAATAAGACTGGAGCTGAGAATGGCCTGCCCGCACCGTTT
GAACCGGTCAGCTCCATCGTACAGAAGTTCGGCGATGTCGGCCTCGACACGAAAGATGTTGTGGTCTTGTCAG
GTATCACACTAATCGTCACAAAAACCAATCTATCTATCTCAAGGTTC
AGAGAAACTTGATTGAAATTCTTTGCTACTTCAATTCCTGAAATTGCCACGCTGTGACCAAACATGCGCAATTCAGACCAGAAGCAACTCTGTTGTCAGTTCCCAAACTAAATCGTAGCT
GACATGGAAAAACTGCCACAGAGGTTTATATGAACAATCATCACGTAACACTCCTAATATATATACGACTGAATGCACAATGGAAATAAAATTTACAGGAGCCCACACGATCGGGCGTGC
CCGGTGCGGGCTGTTCAACAACCGCCTCACGTCGTCAGGCGACCCGACGCTGGACTCCAAAATGGCCGCCAACCTGCAGAGCCTCTGCACCACCGGGGGCGACAACCAGACCACGGCGCT
GGACGTCGAATCCGCCGACGTGTTCGACAAGCAATACTACCAGAACCTGCTGAGCAAGAAGGGCCTCCTGTCCTCGGACCAGAACCTCTTCTCCGGCGCCGAGGACGTCGTCAAGGCCAC
CACCAAGGCGCTGGTGCAGACGTACAGCGACGACGGCGAGCAGTTCTTCATGGACTTCGGCGCCTCCATGGTGAAGATGGGGAGCATCAAGAAGACGGGAGTGCCCGGCGAAATCCGCAC
CAACTGCAGGGTTCCCAATAAGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGTACTCTCACAGCAGGTTGCTCCTTGTATGCTCAGTTCTTATGCTGTGCCTCTGCAGTGGAGTCGCAAAGTGCGATAAGTTAACCAGTGAGCTAACGGGCGATTTCTATGACTAC
ACATGCCCCGGTTTGTATACCATCGTCCAGCAGCATGTGTTTGCTGCCATGAGGGATGAGATGAGGATGGGAGCTTCCCTGCTCAGGCTCCATTTCCATGATTGCTTTGTCAAT
GGGTGT
GATGCTTCGATCCTGTTGGTTGGCGAAACTGGCGAGCAATTTGCGCGTCCCAACCAGAACTCTGTCAGAGGGTACGAGGTCATCGACGCGATGAAGGCCGATATTGAGAGTGTTTGTCCT
GGGGTGGTGTCATGTGCTGACATTGTAGCCCTTGCAGCTGCCTATGGAGTACTCTTT
AGTGGAGGGCCATACTATGAAGTTCTTCTGGGTAGAAAGGACGGCCTGGTAGCAAATAAGACT
GGAGCTGAGAATGGCCTGCCCGCACCGTTTGAACCGGTCAGCTCCATCGTACAGAAGTTCGGCGATGTCGGCCTCGACACGAAAGATGTTGTGGTCTTGTCAG
GAGCCCACACGATCGGG
CGTGCCCGGTGCGGGCTGTTCAACAACCGCCTCACGTCGTCAGGCGACCCGACGCTGGACTCCAAAATGGCCGCCAACCTGCAGAGCCTCTGCACCACCGGGGGCGACAACCAGACCACG
GCGCTGGACGTCGAATCCGCCGACGTGTTCGACAAGCAATACTACCAGAACCTGCTGAGCAAGAAGGGCCTCCTGTCCTCGGACCAGAACCTCTTCTCCGGCGCCGAGGACGTCGTCAAG
GCCACCACCAAGGCGCTGGTGCAGACGTACAGCGACGACGGCGAGCAGTTCTTCATGGACTTCGGCGCCTCCATGGTGAAGATGGGGAGCATCAAGAAGACGGGAGTGCCCGGCGAAATC
CGCACCAACTGCAGGGTTCCCAATAAGTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCCTGCAAGC AGTGCAATAC AGAGTCTAGT AAGTAAAACT GTAAAGGGTT GAGACATGGA GTACTCTCAC AGCAGGTTGC TCCTTGTATG CTCAGTTCTT ATGCTGTGCC TCTGCAGTGG  AGTCGCAAAG TGCGATAAGT TAACCAGTGA GCTAACGGGC GATTTCTATG ACTACACATG CCCCGGTTTG TATACCATCG TCCAGCAGCA TGTGTTTGCT GCCATGAGGG ATGAGATGAG  GATGGGAGCT TCCCTGCTCA GGCTCCATTT CCATGATTGC TTTGTCAATG GGTGTGATGC TTCGATCCTG TTGGTTGGCG AAACTGGCGA GCAATTTGCG CGTCCCAACC AGAACTCTGT  CAGAGGGTAC GAGGTCATCG ACGCGATGAA GGCCGATATT GAGAGTGTTT GTCCTGGGGT GGTGTCATGT GCTGACATTG TAGCCCTTGC AGCTGCCTAT GGAGTACTCT TTAGTGGAGG  GCCATACTAT GAAGTTCTTC TGGGTAGAAA GGACGGCCTG GTAGCAAATA AGACTGGAGC TGAGAATGGC CTGCCCGCAC CGTTTGAACC GGTCAGCTCC ATCGTACAGA AGTTCGGCGA  TGTCGGCCTC GACACGAAAG ATGTTGTGGT CTTGTCAGGA GCCCACACGA TCGGGCGTGC CCGGTGCGGG CTGTTCAACA ACCGCCTCAC GTCGTCAGGC GACCCGACGC TGGACTCCAA  AATGGCCGCC AACCTGCAGA GCCTCTGCAC CACCGGGGGC GACAACCAGA CCACGGCGCT GGACGTCGAA TCCGCCGACG TGTTCGACAA GCAATACTAC CAGAACCTGC TGAGCAAGAA  GGGCCTCCTG TCCTCGGACC AGAACCTCTT CTCCGGCGCC GAGGACGTCG TCAAGGCCAC CACCAAGGCG CTGGTGCAGA CGTACAGCGA CGACGGCGAG CAGTTCTTCA TGGACTTCGG  CGCCTCCATG GTGAAGATGG GGAGCATCAA GAAGACGGGA GTGCCCGGCG AAATCCGCAC CAACTGCAGG GTTCCCAATA AGTGAGCAAC TGCTGGCTAG CAGAGTTCAT CAGCTTCTTG  ACCATCTTGC AAATAACTCA GTCCTTTACA TGTAATGTGT AATATTTAGA TGTTACTACA TGCATGGCAT GCTCGAGAAA CAAGATGAAG AATCAATAAT AATGATGTTA CTCAGAAGAT 
AACGTACAAA CAGATCAATT GATGTGCATG TTGATTTGAT CTGACTCCAT TCAAT 

Retrieve as FASTA