Entry information : BdiPrx19 (Bradi1g27920)
Entry ID 7837
Creation 2011-01-12 (Toky Ramarohetra)
Last sequence changes 2011-01-12 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx19 (Bradi1g27920)
Name (synonym) BdiPrx19 (Bradi1g27920)
Class Class III peroxidase    [Orthogroup: Prx069]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue types Callus
Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx19
start..stop
S start..stop
HvPrx05 537 0 25..339 30..343
TaPrx12 535 0 34..341 37..344
OsPrx125 503 0 34..339 32..336
SiPrx149 489 1e-175 1..339 1..342
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 23097909..23098340 432 N° 2 23098550..23098715 166 N° 3 23098926..23099353 428  
join(23097909..23098340,23098550..23098715,23098926..23099353)


exon

Literature and cross-references BdiPrx19 (Bradi1g27920)
Literature Vogel,J.P., Gu,Y.Q., Twigg,P., Lazo,G.R., Laudencia-Chingcuanco,D., Hayden,D.M., Donze,T.J., Vivian,L.A., Stamova,B. and Coleman-Derr,D.
EST sequencing and phylogenetic analysis of the model grass
Brachypodium distachyon.
Theor Appl Genet 113 (2), 186-195 (2006).


DNA ref. Phytozome 12:   Bd1 (23097909..23099353)
EST ref. GenBank:   DV469507.1 [5' end]   DV472609.1 [5' end]   DV486886.1 [3' end]   GT816637.1 [3' end]   GT822178.1 [3' end]
Protein sequence: BdiPrx19 (Bradi1g27920)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   341 (312)
PWM (Da):   %s   36368.9 (33625.5)  
PI (pH):   %s   5.35 (4.99) Peptide Signal:   %s   cut: 30 range:30-341
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPPSSPRVSLSGAALLAMACLLLHGGAAAAAGELCADYYDCTCPDAYKIVQGVLIEAHRSDPRIFASLIRLHFHDCFVQGCDASLLLDSFPGMQSEKDARPNNNSARGFPVVDAAKAALEDACPGVVSCADILALAAEISVQLSGGPGWSVLLGRLDGKTTDFNGAQNLPGPFDGLPMLKRKFRDVGLDDTTDLVALSGGHTFGRVQCQFVTGRLYNFSNTNMPDPTLDSRYRAFLSQRCPRNGPAASLNDLDPTTPDAFDNHYFTNLEVNRGFLQSDQELKSDPGALTTTAPIVDRFASSQEAFFRSFALSMIKMGNIQPLTDPSKGEVRAHCARVNAS

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, intron 2 and 3), 5 ESTs. Cultivar="Bd21".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCTCCTTCTTCTCCCCGCGTCTCTCTTAGCGGCGCCGCCTTGCTGGCCATGGCGTGCCTTCTTCTCCACGGCGGGGCGGCGGCGGCGGCGGGGGAGCTGTGCGCGGACTACTAC
GACTGCACGTGCCCGGACGCGTACAAGATCGTGCAGGGGGTCCTGATCGAGGCCCACAGGTCGGACCCTCGCATCTTCGCCAGCCTCATCCGGCTGCACTTCCACGACTGCTTCGTGCAG
GGCTGCGACGCGTCCTTGCTCCTGGACAGCTTTCCCGGGATGCAGTCCGAGAAGGACGCCAGGCCCAACAACAACTCGGCCCGTGGGTTCCCCGTCGTCGACGCCGCCAAGGCCGCCCTC
GAGGACGCCTGCCCCGGCGTCGTCTCCTGCGCCGACATCCTCGCCCTCGCCGCCGAGATCTCCGTCCAGCTC
GTACGTACACATAGTATCGATCATTACATACTGCATGCATGATTGGTA
TTTGGTACGTAAGCAGTAGGACTGTACGTCAGTAGGTAGCTTTCAGCTAGCCTTTCAGACTCTGAACGTGCATGATTTGCGTTGTCGTGTGTCGGTGGATGCAAGAACAGCAAACGAGTC
GAGGAAAAATAATAATGCTAGCTTGGCATATATATGTGCAGTCCGGAGGCCCCGGGTGGAGCGTGCTGCTGGGGAGGCTGGACGGCAAGACCACCGACTTCAACGGCGCCCAGAACCTCC
CGGGACCGTTCGATGGCCTGCCGATGCTCAAGAGAAAGTTCCGGGACGTCGGCCTCGACGATACTACCGACCTCGTCGCCCTCTCAG
GTAACCAAATGCTACCTCTGTTCCATAATACTT
GTCTTAAATTTAAATGGATGTATTAATTTATTTCTAACAAGTGTTTAGATACATGTAATATTTCGACAAGAATTATGGAACAGAGAAAGTACTTACTTCTGTTTAATTACAAACTTGACT
GGTAAACGATTTTAATTATAATTAACTTTGTCTTAATTTGTTTCAAATAATGTGTAGGTGGCCACACTTTCGGCCGTGTGCAATGCCAGTTCGTCACGGGCCGGCTGTACAACTTCAGCA
ACACGAACATGCCCGACCCGACCCTGGACTCGCGCTACCGAGCGTTCCTATCTCAGAGATGCCCAAGGAACGGTCCTGCGGCCTCTCTGAACGACCTCGACCCGACAACACCGGACGCCT
TCGACAACCACTACTTCACCAACCTGGAAGTGAACCGTGGGTTCCTTCAGTCCGACCAGGAGCTCAAGTCCGACCCCGGGGCGCTGACCACCACGGCGCCCATCGTCGACCGGTTCGCGA
GCAGCCAGGAGGCCTTCTTCAGGAGCTTCGCTCTGTCCATGATCAAGATGGGGAACATCCAGCCGCTGACTGACCCGTCAAAAGGAGAAGTCCGGGCACACTGCGCCAGGGTCAATGCAA
GTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCTCCTTCTTCTCCCCGCGTCTCTCTTAGCGGCGCCGCCTTGCTGGCCATGGCGTGCCTTCTTCTCCACGGCGGGGCGGCGGCGGCGGCGGGGGAGCTGTGCGCGGACTACTAC
GACTGCACGTGCCCGGACGCGTACAAGATCGTGCAGGGGGTCCTGATCGAGGCCCACAGGTCGGACCCTCGCATCTTCGCCAGCCTCATCCGGCTGCACTTCCACGACTGCTTCGTGCAG
GGCTGCGACGCGTCCTTGCTCCTGGACAGCTTTCCCGGGATGCAGTCCGAGAAGGACGCCAGGCCCAACAACAACTCGGCCCGTGGGTTCCCCGTCGTCGACGCCGCCAAGGCCGCCCTC
GAGGACGCCTGCCCCGGCGTCGTCTCCTGCGCCGACATCCTCGCCCTCGCCGCCGAGATCTCCGTCCAGCTC
TCCGGAGGCCCCGGGTGGAGCGTGCTGCTGGGGAGGCTGGACGGCAAG
ACCACCGACTTCAACGGCGCCCAGAACCTCCCGGGACCGTTCGATGGCCTGCCGATGCTCAAGAGAAAGTTCCGGGACGTCGGCCTCGACGATACTACCGACCTCGTCGCCCTCTCAG
GT
GGCCACACTTTCGGCCGTGTGCAATGCCAGTTCGTCACGGGCCGGCTGTACAACTTCAGCAACACGAACATGCCCGACCCGACCCTGGACTCGCGCTACCGAGCGTTCCTATCTCAGAGA
TGCCCAAGGAACGGTCCTGCGGCCTCTCTGAACGACCTCGACCCGACAACACCGGACGCCTTCGACAACCACTACTTCACCAACCTGGAAGTGAACCGTGGGTTCCTTCAGTCCGACCAG
GAGCTCAAGTCCGACCCCGGGGCGCTGACCACCACGGCGCCCATCGTCGACCGGTTCGCGAGCAGCCAGGAGGCCTTCTTCAGGAGCTTCGCTCTGTCCATGATCAAGATGGGGAACATC
CAGCCGCTGACTGACCCGTCAAAAGGAGAAGTCCGGGCACACTGCGCCAGGGTCAATGCAAGTTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACGTGTCCTA GTATTATCCT ATAAGTATAG TACGTAGTAT ACCAAGATAA GTTAACCTGG GAAATGCGAT GCATGCATGC TGTGCTAAAA GTAAGATTGA GACCAGTAAA CAACTGGAGT  AGCAACTGTG CAGTGCTTAT AATCTGCCTA TAAATCAAGC CTTTCTTCTC GTCCCACTAC TCGTCAATCA AAGCAATCCT CAGCAAAGAT GGCTCCTCCT TCTTCTCCCC GCGTCTCTCT  TAGCGGCGCC GCCTTGCTGG CCATGGCGTG CCTTCTTCTC CACGGCGGGG CGGCGGCGGC GGCGGGGGAG CTGTGCGCGG ACTACTACGA CTGCACGTGC CCGGACGCGT ACAAGATCGT  GCAGGGGGTC CTGATCGAGG CCCACAGGTC GGACCCTCGC ATCTTCGCCA GCCTCATCCG GCTGCACTTC CACGACTGCT TCGTGCAGGG CTGCGACGCG TCCTTGCTCC TGGACAGCTT  TCCCGGGATG CAGTCCGAGA AGGACGCCAG GCCCAACAAC AACTCGGCCC GTGGGTTCCC CGTCGTCGAC GCCGCCAAGG CCGCCCTCGA GGACGCCTGC CCCGGCGTCG TCTCCTGCGC  CGACATCCTC GCCCTCGCCG CCGAGATCTC CGTCCAGCTC TCCGGAGGCC CCGGGTGGAG CGTGCTGCTG GGGAGGCTGG ACGGCAAGAC CACCGACTTC AACGGCGCCC AGAACCTCCC  GGGACCGTTC GATGGCCTGC CGATGCTCAA GAGAAAGTTC CGGGACGTCG GCCTCGACGA TACTACCGAC CTCGTCGCCC TCTCAGGTGG CCACACTTTC GGCCGTGTGC AATGCCAGTT  CGTCACGGGC CGGCTGTACA ACTTCAGCAA CACGAACATG CCCGACCCGA CCCTGGACTC GCGCTACCGA GCGTTCCTAT CTCAGAGATG CCCAAGGAAC GGTCCTGCGG CCTCTCTGAA  CGACCTCGAC CCGACAACAC CGGACGCCTT CGACAACCAC TACTTCACCA ACCTGGAAGT GAACCGTGGG TTCCTTCAGT CCGACCAGGA GCTCAAGTCC GACCCCGGGG CGCTGACCAC  CACGGCGCCC ATCGTCGACC GGTTCGCGAG CAGCCAGGAG GCCTTCTTCA GGAGCTTCGC TCTGTCCATG ATCAAGATGG GGAACATCCA GCCGCTGACT GACCCGTCAA AAGGAGAAGT  CCGGGCACAC TGCGCCAGGG TCAATGCAAG TTAGGGATCG AGATGAGTGA CTACCGGACA CGTGTGGTCG TGTGGATATA TGTGTGTCTG TATTCATGGA TGTAAGGATG AATTTATCTC  TTACTGTCCA GTTTAATAAT TGGTAGACAT ACCGACCAAT GTAATTAAAC ATTTTATGCC CTGCTTGTTC TTGATCGGAT ATGCTATGAA GATGGGAACC GTTTTGTTTC CCCGCCCGCT 
TTCGTATGGA ATGGTTTTCA ACATTATCAT ATCGAGAATA ATATTTCT 

Retrieve as FASTA