Entry information : BdiPrx42 (Bradi1g63060)
Entry ID 7840
Creation 2011-01-12 (Toky Ramarohetra)
Last sequence changes 2011-01-12 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx42 (Bradi1g63060)
Name (synonym) BdiPrx42 (Bradi1g63060)
Class Class III peroxidase    [Orthogroup: Prx009]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx42
start..stop
S start..stop
SbPrx17 463 6e-166 28..321 23..318
SiPrx122 447 2e-159 15..321 27..338
AvePrx114-1C 438 5e-156 35..321 31..321
AvePrx114-1B 436 3e-155 35..321 31..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 62268571..62268792 222 N° 2 62269218..62269409 192 N° 3 62269600..62269765 166 N° 4 62271243..62271628 386
join(62268571..62268792,62269218..62269409,62269600..62269765,62271243..62271628 )


exon

Literature and cross-references BdiPrx42 (Bradi1g63060)
DNA ref. Phytozome 12:   Bd1 (62268571..62271628)
Protein sequence: BdiPrx42 (Bradi1g63060)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321 (292)
PWM (Da):   %s   32520.08 (29913.6) Transmb domain:   %s   i7-29o
PI (pH):   %s   4.5 (4.50) Peptide Signal:   %s   cut: 30 range:30-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGFSGGSVVPPAVATAILLLLGLAAAASAQLSATFYDASCPSALATIKSAVTAAVSKEPRMGASLLRLHFHDCFGCDASVLLADTANFTGEQTAFPNANSIRGLDVIDTVKAQVEAVCTQIVSCADILAVAARDSVVTLGGPSYTVPLGRRDSTTASLSLANNDLPPPTSDLADLVGNFSRKGLSTTDMVALSGAHTIGQAACTNFQSRIYGESNINAAYAASLQANCPQSGGDGNFAPLDVATPNAFDNAYYGNLVSQQGLLHSDQQLLNGGSTDALVSTYASSATQFSADFAAAMVSMGNIGVLTGSQGQIRLNCAKVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, intron 1, 2 and 3), No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGTTTTCCGGCGGCAGCGTCGTTCCTCCAGCTGTGGCGACGGCGATCCTGCTGCTGCTGGGCCTGGCCGCGGCGGCGTCGGCTCAGCTGTCGGCGACGTTCTACGACGCGTCCTGC
CCGAGCGCGCTTGCGACGATCAAGAGCGCCGTGACGGCGGCGGTGAGCAAGGAGCCACGCATGGGGGCTTCCCTGCTCAGGCTTCACTTCCACGACTGCTTT
GTCCAAGCAAGTCACCTT
ACATCTCTCTCTGTTTCTCGCCCTCTGGCCTCTGCTTCCGTACAAATCCAGTATGTAGTGATTCAGATAAAGTGCGACCCTTGTATCTGCTTGCATAAATCAGTACTGCTGCTGCTGTTG
AATTTTTCCAACGTACTCTCTCCGTTCCAAATTAACTGTCATGGATTACATGATGTTGATCATGCATGCCACGTCAAATTAACGGCTAATTTGCATTCGCTGGCTTTTATCTTGTACGTT
ACGTTATTAACACCGGTAGCTGGCTGCTGGCGGCCCGATCGACGTGTATCTATTTTGTAGCTGCACGTACGTACGCAAACTAGCTATCACGTCGATTTACACACTGTAGTGTCGACGGTG
GGTTCTAAGCTGGCTTGCATATACATGCATGTCGTGGTGTGTGACAGGGATGCGACGCGTCGGTGCTGCTTGCCGACACCGCCAACTTCACCGGTGAGCAGACCGCTTTCCCCAACGCCA
ACTCCATCAGAGGCCTCGACGTCATCGACACCGTCAAGGCGCAGGTCGAGGCCGTCTGCACGCAGATCGTCTCCTGCGCCGATATCCTCGCCGTCGCCGCCCGTGACTCGGTCGTCACG
G
TAATTAATGGCAAGCTTCATGTCCTAGCCAATGCAACCAAAAGACCGATTTTATGAAAGTGGCTAAACAATCCATTTATATTTCAACAATTAACTCTACTTCTAAACCAAATATGATGAA
TATATAGAATTATATATAGATCAACCGTAGTTTTTGAGAACTAAAGGTCGATTGATTATTTACTTGCAGCTAGGAGGGCCGTCGTATACGGTTCCATTGGGGAGGAGGGACTCCACCACG
GCGAGCCTCTCCCTGGCGAACAACGACCTCCCTCCGCCCACCTCCGACCTTGCCGATCTCGTCGGCAACTTCTCCAGGAAGGGGCTCAGCACCACCGACATGGTTGCACTATCAG
GTAAT
TATTCGGGACCTCTGCTGATTTGCTTCAGTTAAGTTTCGGGGCGCAATGTATAGGCAGCAGACTTAACAAGTGAAGACGTTTCAGTTTTTCACGTGCTCGTTTAGAAAGTAGAACATGCC
TCCTCGATCACAGATCATTGTTCACAGAAAAATGACACGCATTTTTTTTTCTTTTACATCAGAAAATGACATGATGCTAACAACCCTACAATTGATATGACGAGCAATGACACGTATGTT
TTTTCTCTTTAATTTACACCAGAGAAATGACATGTATGCTAACAACCCAACAATTTGATATGACGACAATGACACGTATGTTTTTTTCTTTTTCACCAGAGAAATGACATGTATGCTAAC
AACCCTACAATTTGATATGACGAGCAATACCTACATGGCTACATAGTTAGTAACCGGCGAGTGACAAGTGACCAGACGGTGGCATCTATAGCAGATGATCAGACCTTACATTTATTTATA
ATTACTTTGCTACAAAATGCTCCATCCGTTCCTCATTTTTTTTACGTTGTTTTAGTTCAAATTTGCACTAAAATCGCGACAAGAATTTAGAGACGGAGGGAACAGTATTTGTTATATATG
TGCATTTTTCACATTAGGGTGTCTAATTTTTTCCAAGAGTCTAAAAAACATGTGCGCATAAGAGATACGTGTATTTTTTCGTCCTTCAACTAAAATTTGGACTTTGTCTGTCAACTATAT
TTTGGTACACATTTTGTCCCTCAACTATTGGCATCGGTTAAATTTGGTCTCATGTCGGTTTAGGATGATCAAAACTGGATTTGACCTGACCAGCTGATGGATGGACTGATCAGTGCCATG
ATGTCGCAATTTTTTGTGGACCTCACCCTACCATCCCATGAAAAATCATCACATCATGTGCCAACATGGTTAAAAGTCAACCATTCATCCGTCATGTCAGGTCAATTTTGGTTTGACGTA
CCATGCTAAACTAGCATGTGGACCAAATTTGCCCAATATTGAAAATTGAATGACCAAGTTCGTGCAAATAGGTGTTGAGGAACAAAGTCTGTACTTTCTCAAGAGTTGAGAGACGAAGTC
TGTACTTCCGCAATTATTGAGAGACGAAACTACACTTAGCCATGGACTAATTAATCCCATTTAAAAGGATAGCTGAGCTGGAACCATCAAAAGAGAAATCACGTCGTCCACGAGACCAGG
ACAGCTTAACAAACATTTTTGGGGTAGGCAGCCAGCAGACTTCTTCCAGCCAGTCTGCATGCTGCTCCTTACGCAGTCCGCCGTCGCCACACGGATCCCAGCCGTGGCATGCATGCACCG
CTCAAAGCTGCACGATCCGGTGCACCCAGCCCTTGTTGCGTAGGGCAACAAGGCATGCAGCACCAGGGTTTTGAGAATTCCAAAAGTATACATGGCTCTTAATTTCAACATTATCTTTTC
TCAAATTCTAAATATGTGACCCATGCATGCAGGAGCCCACACGATCGGGCAGGCGGCGTGCACCAACTTCCAGAGCCGAATCTACGGCGAGTCCAACATCAATGCGGCGTACGCGGCGTC
ACTGCAGGCCAACTGCCCTCAGTCCGGCGGCGACGGCAACTTCGCGCCGCTTGACGTGGCGACCCCCAACGCCTTCGACAATGCTTACTACGGCAACCTGGTCTCGCAGCAAGGGCTCCT
CCACTCCGACCAGCAGCTCCTCAACGGCGGATCCACCGACGCCCTTGTCAGCACCTACGCGTCCAGTGCCACTCAGTTCAGCGCCGACTTCGCAGCGGCCATGGTGAGCATGGGCAATAT
CGGCGTGCTCACGGGCTCTCAAGGGCAGATCAGGCTCAACTGCGCCAAGGTAAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGTTTTCCGGCGGCAGCGTCGTTCCTCCAGCTGTGGCGACGGCGATCCTGCTGCTGCTGGGCCTGGCCGCGGCGGCGTCGGCTCAGCTGTCGGCGACGTTCTACGACGCGTCCTGC
CCGAGCGCGCTTGCGACGATCAAGAGCGCCGTGACGGCGGCGGTGAGCAAGGAGCCACGCATGGGGGCTTCCCTGCTCAGGCTTCACTTCCACGACTGCTTT
GGATGCGACGCGTCGGTG
CTGCTTGCCGACACCGCCAACTTCACCGGTGAGCAGACCGCTTTCCCCAACGCCAACTCCATCAGAGGCCTCGACGTCATCGACACCGTCAAGGCGCAGGTCGAGGCCGTCTGCACGCAG
ATCGTCTCCTGCGCCGATATCCTCGCCGTCGCCGCCCGTGACTCGGTCGTCACG
CTAGGAGGGCCGTCGTATACGGTTCCATTGGGGAGGAGGGACTCCACCACGGCGAGCCTCTCCCTG
GCGAACAACGACCTCCCTCCGCCCACCTCCGACCTTGCCGATCTCGTCGGCAACTTCTCCAGGAAGGGGCTCAGCACCACCGACATGGTTGCACTATCAG
GAGCCCACACGATCGGGCAG
GCGGCGTGCACCAACTTCCAGAGCCGAATCTACGGCGAGTCCAACATCAATGCGGCGTACGCGGCGTCACTGCAGGCCAACTGCCCTCAGTCCGGCGGCGACGGCAACTTCGCGCCGCTT
GACGTGGCGACCCCCAACGCCTTCGACAATGCTTACTACGGCAACCTGGTCTCGCAGCAAGGGCTCCTCCACTCCGACCAGCAGCTCCTCAACGGCGGATCCACCGACGCCCTTGTCAGC
ACCTACGCGTCCAGTGCCACTCAGTTCAGCGCCGACTTCGCAGCGGCCATGGTGAGCATGGGCAATATCGGCGTGCTCACGGGCTCTCAAGGGCAGATCAGGCTCAACTGCGCCAAGGTA
AATTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGTTTT CCGGCGGCAG CGTCGTTCCT CCAGCTGTGG CGACGGCGAT CCTGCTGCTG CTGGGCCTGG CCGCGGCGGC GTCGGCTCAG CTGTCGGCGA CGTTCTACGA CGCGTCCTGC  CCGAGCGCGC TTGCGACGAT CAAGAGCGCC GTGACGGCGG CGGTGAGCAA GGAGCCACGC ATGGGGGCTT CCCTGCTCAG GCTTCACTTC CACGACTGCT TTGGATGCGA CGCGTCGGTG  CTGCTTGCCG ACACCGCCAA CTTCACCGGT GAGCAGACCG CTTTCCCCAA CGCCAACTCC ATCAGAGGCC TCGACGTCAT CGACACCGTC AAGGCGCAGG TCGAGGCCGT CTGCACGCAG  ATCGTCTCCT GCGCCGATAT CCTCGCCGTC GCCGCCCGTG ACTCGGTCGT CACGCTAGGA GGGCCGTCGT ATACGGTTCC ATTGGGGAGG AGGGACTCCA CCACGGCGAG CCTCTCCCTG  GCGAACAACG ACCTCCCTCC GCCCACCTCC GACCTTGCCG ATCTCGTCGG CAACTTCTCC AGGAAGGGGC TCAGCACCAC CGACATGGTT GCACTATCAG GAGCCCACAC GATCGGGCAG  GCGGCGTGCA CCAACTTCCA GAGCCGAATC TACGGCGAGT CCAACATCAA TGCGGCGTAC GCGGCGTCAC TGCAGGCCAA CTGCCCTCAG TCCGGCGGCG ACGGCAACTT CGCGCCGCTT  GACGTGGCGA CCCCCAACGC CTTCGACAAT GCTTACTACG GCAACCTGGT CTCGCAGCAA GGGCTCCTCC ACTCCGACCA GCAGCTCCTC AACGGCGGAT CCACCGACGC CCTTGTCAGC  ACCTACGCGT CCAGTGCCAC TCAGTTCAGC GCCGACTTCG CAGCGGCCAT GGTGAGCATG GGCAATATCG GCGTGCTCAC GGGCTCTCAA GGGCAGATCA GGCTCAACTG CGCCAAGGTA  AATTGAGTGA AAGTGACAAA ACCCATATAT ATAAATTTGT GGAGCATTTG CGACTGCCAG TTAGTTGGGA TGGCAACTTT ACAAGAATTG AGTAACAATG AAAGTCTTTT TTTCCCGAGT 
AATA 

Retrieve as FASTA