Entry information : PmAPx-CcP01
Entry ID 7844
Creation 2011-01-12 (Marcel Zamocky)
Last sequence changes 2011-01-17 (Christophe Dunand)
Sequence status complete
Reviewer Myriam Duval
Last annotation changes 2011-01-19 (Myriam Duval)
Peroxidase information: PmAPx-CcP01
Name PmAPx-CcP01
Class Hybrid Ascorbate-Cytochrome C peroxidase    [Orthogroup: APx-CcP001]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Trichocomaceae Penicillium
Organism Penicillium marneffei    [TaxId: 37727 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PmAPx-CcP01
start..stop
S start..stop
TstAPx-CcP 692 0 1..380 1..379
CgeoAPx-CcP01 491 1e-174 1..379 1..378
MicaAPx-CcP01 499 9e-173 22..380 20..379
TrubrAPx-CcP01 496 2e-171 6..380 5..379
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3266187..3267320 1134 N° 2 3267383..3267451 69  
join(3266187..3267320,3267383..3267451)


exon

Literature and cross-references PmAPx-CcP01
Protein ref. UniProtKB:   B6QKD8
DNA ref. GenBank:   DS995902.1 (3266187..3267451)
Protein sequence: PmAPx-CcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   400 (379)
PWM (Da):   %s   42237.84 (40120.8)  
PI (pH):   %s   4.35 (4.39) Peptide Signal:   %s   cut: 22 range:22-400
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMGEWLLLLTAASSILGSVSGLPTWPSSVDELEDIMFLNTGYQARAFSADITPCSFSSQGPSRIASAEWLRTAFHDMAPGNVVTGVGGIDASLQYELGGGGGENIGAAFNSTLLSFTPFFSSRASLADIIALGVYASVRVCGGPIIPIRTGRIDATGAGPIGVPLPQNSQYTFIQQFLRMGFNVSEMIALTACGHTIGGVHANNFPEVLQSGTVPNDYQHFDSTTVFDEKIASEYVGGNSSDLLAGPLAVKNTFDSDIAVFTADNNATISLMVNPTYFQSRCQVMLQRMIEVVPAGVVLTDAIAPYEVKPSNLQLTIQPGGTQLQFTGEIRVRTTDLSGNISNVQLVYVDRNGASTCGSCVIGTHYAGSANGFDDSFVLFRNIAGHNLNFGIYSTGDSWR*

Retrieve as FASTA  
Remarks complete sequence from genomic (1 intron). Strain="ATCC 18224 / CBS 334.59 / QM 7333".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGGGTGAGTGGCTACTGTTGCTGACGGCGGCCAGCTCAATCCTAGGGTCTGTCTCAGGATTGCCGACATGGCCATCATCAGTGGATGAACTAGAAGATATCATGTTCCTGAATACT
GGCTACCAGGCCCGGGCTTTTTCTGCGGATATCACACCATGTTCCTTCTCATCGCAAGGTCCATCGAGAATTGCTTCCGCAGAATGGCTTCGCACAGCTTTCCATGACATGGCTCCTGGT
AACGTCGTCACCGGGGTTGGCGGAATAGACGCGTCTCTGCAATATGAGTTGGGAGGAGGTGGCGGTGAAAACATTGGTGCCGCCTTTAATTCGACTCTGCTCTCATTCACGCCTTTCTTT
TCCTCTCGTGCCTCGCTGGCCGATATCATTGCATTGGGCGTGTATGCATCTGTCCGGGTCTGTGGCGGTCCCATCATTCCTATTCGCACAGGCCGTATCGATGCCACTGGAGCGGGACCG
ATAGGAGTGCCGTTGCCACAGAATTCACAATATACTTTCATCCAACAGTTTTTGCGGATGGGCTTTAATGTCTCGGAAATGATCGCCCTAACGGCTTGCGGCCACACTATCGGTGGTGTT
CACGCCAATAATTTCCCTGAGGTGCTACAGTCGGGGACCGTGCCAAACGACTATCAGCACTTCGATTCGACAACAGTGTTTGATGAGAAGATTGCCTCCGAATATGTCGGTGGCAACAGC
TCAGATCTGCTGGCTGGGCCATTGGCAGTAAAAAACACGTTCGACTCGGATATAGCAGTATTTACCGCAGACAACAATGCGACAATTAGTCTCATGGTCAACCCGACGTACTTTCAATCC
CGCTGCCAGGTGATGCTTCAGCGTATGATCGAGGTTGTCCCGGCTGGAGTAGTTCTCACGGACGCAATTGCTCCTTATGAGGTCAAACCGAGTAACCTACAATTAACCATACAGCCAGGT
GGTACTCAGCTTCAGTTTACTGGTGAAATTCGGGTCCGAACAACCGATCTCAGCGGTAATATTTCCAACGTTCAGCTTGTATATGTTGACCGCAACGGCGCCTCTACTTGCGGATCCTGT
GTTATTGGGACGCACTATGCGGGATCGGCAAATGGTTTTGATGATTCCTTTGTC
GTAAGTTTCTCCTTGGCTGCAAAGGAATTTAGAGTTGATGGTAGACGTGAATAGTTCTACAGCTTT
TCCGCAATATTGCCGGCCACAACCTCAATTTCGGCATTTACAGTACAGGTGACAGCTGGCGGTAA

Retrieve as FASTA