Entry information : BdiPrx45 (Bradi1g68890)
Entry ID 7846
Creation 2011-01-13 (Toky Ramarohetra)
Last sequence changes 2011-01-13 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx45 (Bradi1g68890)
Name (synonym) BdiPrx45 (Bradi1g68890)
Class Class III peroxidase    [Orthogroup: Prx023]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx45
start..stop
S start..stop
SiPrx153 525 0 29..334 28..332
ZmPrx13 520 0 29..334 28..334
SbPrx19 519 0 33..334 30..332
OsPrx38 504 0 1..334 1..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 67349688..67349927 240 N° 2 67350031..67350213 183 N° 3 67350315..67350480 166 N° 4 67350581..67350996 416
join(67349688..67349927,67350031..67350213,67350315..67350480,67350581..67350996 )


exon

Literature and cross-references BdiPrx45 (Bradi1g68890)
DNA ref. Phytozome 12:   Bd1 (67349688..67350996)
Protein sequence: BdiPrx45 (Bradi1g68890)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   334 (301)
PWM (Da):   %s   34980.3 (31587.6) Transmb domain:   %s   i13-32o
PI (pH):   %s   6.03 (5.35) Peptide Signal:   %s   cut: 34 range:34-334
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEYSAGRDRRSRLCCLLGVVAAVLLCLGTAASGELTDDFYDDCCPNLDRIVRARVSAAMKAEPRMGASLLRLHFHDCFVNGCDGSILLDGSNSEKLAAPNLNSARGFEVVDAIKADIERACPGHVSCADVLALAAKYGVLLSGGPDYDVLLGRRDGLVANQSGADSNLPGPDDSISDITKRFKDVGLNTTDMVVLSGGHTIGRSRCALFSNRLANFSATNSVDPTLDSALASSLQQVCRGGDGNQTAALDDGSADAFDNHYFKNLLAKKGLLSSDQILFSSADAAAATKALVQAYGADSQRFFCDFGNSMVKMGNIAPLTGSAGQIRKKCRAVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (Chromo 1, intron 1, 2 and 3), no EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGTACTCTGCAGGCAGAGATCGTAGGAGCCGGCTCTGCTGCTTGCTCGGAGTCGTCGCAGCCGTGCTGCTGTGCCTGGGAACCGCGGCGAGCGGCGAGCTGACGGACGACTTCTAC
GACGACTGCTGCCCCAACCTGGACAGGATCGTCCGGGCGCGCGTGTCCGCCGCCATGAAGGCCGAGCCCAGGATGGGCGCCTCTCTGCTCAGGCTCCACTTCCACGACTGCTTCGTCAAC
GTACGTAAACACACATGCATGCACCTCTGTTTTGGACTCTGTCCTCGATCATGTTTTGCTGAAAAAGACTTGAATGCACGTGTGCGCGCATGCATGCATGCAGGGTTGCGACGGGTCGAT
CCTGCTGGACGGGAGCAACAGCGAGAAGCTGGCGGCGCCGAACCTGAACTCGGCGAGGGGATTCGAGGTCGTGGACGCCATCAAGGCCGACATCGAGCGCGCGTGCCCCGGGCACGTTTC
ATGCGCCGACGTCCTCGCGCTCGCCGCTAAATATGGCGTACTGCTG
GTTCGGTTTCCTTCCTCCACCGTATCAAGTTGGTTCAAGGAACATGTTGTCCTTTTCTTTAAGCATGCAAGCAT
GACACTGTATTTTGCTGATATGTCCAGAGTGGAGGGCCTGATTACGATGTTCTCCTGGGAAGAAGGGACGGTCTGGTGGCGAATCAGTCCGGAGCTGACAGCAACCTGCCGGGGCCGGAC
GATTCGATCAGCGATATCACAAAGAGGTTCAAGGACGTCGGCTTGAATACAACCGACATGGTCGTCTTATCAG
GTACGGGTGTCAGTATTAGTATCAGACTATCAGCCCTTTGCGATCTG
TATGTATAGCTGAATTATCAGTGGTTGGTTGCTGAACCGAATTGCATGTACAGGAGGCCACACGATCGGGCGATCCCGGTGCGCGCTCTTCAGCAACCGGCTGGCCAACTTCTCGGCGAC
CAACTCGGTGGACCCGACGCTGGACTCGGCGCTGGCGTCCAGCCTGCAGCAGGTGTGCCGGGGCGGGGACGGCAACCAGACGGCGGCGCTGGACGACGGCTCCGCCGACGCCTTCGACAA
CCACTACTTCAAGAACCTGCTCGCCAAGAAGGGCCTCCTCTCCTCGGACCAGATCCTCTTCTCCAGCGCCGACGCCGCGGCCGCCACCAAGGCGCTCGTGCAGGCCTACGGCGCCGACAG
CCAGCGCTTCTTCTGCGACTTCGGCAACTCCATGGTCAAGATGGGCAACATCGCCCCGCTCACCGGCTCGGCCGGCCAGATCCGCAAGAAATGCAGAGCAGTCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGTACTCTGCAGGCAGAGATCGTAGGAGCCGGCTCTGCTGCTTGCTCGGAGTCGTCGCAGCCGTGCTGCTGTGCCTGGGAACCGCGGCGAGCGGCGAGCTGACGGACGACTTCTAC
GACGACTGCTGCCCCAACCTGGACAGGATCGTCCGGGCGCGCGTGTCCGCCGCCATGAAGGCCGAGCCCAGGATGGGCGCCTCTCTGCTCAGGCTCCACTTCCACGACTGCTTCGTCAAC
GGTTGCGACGGGTCGATCCTGCTGGACGGGAGCAACAGCGAGAAGCTGGCGGCGCCGAACCTGAACTCGGCGAGGGGATTCGAGGTCGTGGACGCCATCAAGGCCGACATCGAGCGCGCG
TGCCCCGGGCACGTTTCATGCGCCGACGTCCTCGCGCTCGCCGCTAAATATGGCGTACTGCTG
AGTGGAGGGCCTGATTACGATGTTCTCCTGGGAAGAAGGGACGGTCTGGTGGCGAAT
CAGTCCGGAGCTGACAGCAACCTGCCGGGGCCGGACGATTCGATCAGCGATATCACAAAGAGGTTCAAGGACGTCGGCTTGAATACAACCGACATGGTCGTCTTATCAG
GAGGCCACACG
ATCGGGCGATCCCGGTGCGCGCTCTTCAGCAACCGGCTGGCCAACTTCTCGGCGACCAACTCGGTGGACCCGACGCTGGACTCGGCGCTGGCGTCCAGCCTGCAGCAGGTGTGCCGGGGC
GGGGACGGCAACCAGACGGCGGCGCTGGACGACGGCTCCGCCGACGCCTTCGACAACCACTACTTCAAGAACCTGCTCGCCAAGAAGGGCCTCCTCTCCTCGGACCAGATCCTCTTCTCC
AGCGCCGACGCCGCGGCCGCCACCAAGGCGCTCGTGCAGGCCTACGGCGCCGACAGCCAGCGCTTCTTCTGCGACTTCGGCAACTCCATGGTCAAGATGGGCAACATCGCCCCGCTCACC
GGCTCGGCCGGCCAGATCCGCAAGAAATGCAGAGCAGTCAACTGA

Retrieve as FASTA