Entry information : BdiPrx47 (Brady1g68930)
Entry ID 7847
Creation 2011-01-13 (Toky Ramarohetra)
Last sequence changes 2011-01-13 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx47 (Brady1g68930)
Name (synonym) BdiPrx47 (Brady1g68930)
Class Class III peroxidase    [Orthogroup: Prx132]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx47
start..stop
S start..stop
SbPrx21 478 1e-171 21..328 18..331
ZmPrx17 477 5e-171 27..328 23..329
SiPrx151 457 2e-163 25..328 29..339
OsPrx37 445 2e-158 29..329 28..333
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 67391481..67391702 222 N° 2 67391198..67391389 192 N° 3 67390929..67391091 163 N° 4 67390412..67390827 416
complement(join(67390412..67390827,67390929..67391091,67391198..67391389,6739148 1..67391702))


exon

Literature and cross-references BdiPrx47 (Brady1g68930)
DNA ref. Phytozome 12:   Bd1 (67391702..67390412)
Protein sequence: BdiPrx47 (Brady1g68930)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (304)
PWM (Da):   %s   35044.54 (32624.2)  
PI (pH):   %s   4.73 (4.65) Peptide Signal:   %s   cut: 27 range:27-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGSPSAVPVAALSLALCALLAAVSRAQQLSPAFYDGSCPHVDDTARRVIQEARVADPRILASLVRLQFHDCFVNGCDGSLLLDDSPAVRSEKNAAPNNNSARGFPVVDDIKAALEHACPGIVSCADILALAAEISVELAGGPYWRVMLGRRDATTANFEGADNLPGPTDALGVLREKFASLGLDDTDFVALQGAHTIGRAQCRFVQDRLAEQPDPALDREFLSALRQFCPASAGVDERLNNLDPATPDAFDNSYYVNILRNRGLLRSDQAMLSVPDGAAAATAPIVGRFADSEADFFRSFATAMIKMGNIAPLTGDMGEVRRHCRVVNQS

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, intron 1, 2 and 3), no EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGTCTCCTTCCGCCGTTCCAGTAGCAGCGCTGAGCCTGGCCTTGTGCGCCTTGCTCGCCGCCGTGTCGAGGGCGCAGCAGCTGAGCCCTGCGTTCTACGACGGCTCGTGCCCGCAC
GTCGACGACACGGCGCGGCGCGTCATCCAGGAGGCCCGGGTCGCCGACCCGCGCATCCTCGCCAGCCTCGTCCGCCTCCAGTTCCACGACTGCTTCGTCAAT
GTACGTAGTAACAACGTG
TTGTGCCCGCACTGGCCGCAGGTTGTGTGTGGTGTTAATTTGAGCTCGAGCTAATTAACGTGTGTGTTTGCAGGGCTGTGACGGGTCGTTGCTGCTGGACGACAGCCCGGCGGTAAGAAG
CGAGAAGAACGCCGCACCGAACAACAACTCGGCCCGGGGGTTCCCGGTGGTGGACGACATCAAGGCCGCCCTGGAGCACGCTTGCCCCGGCATCGTCTCCTGTGCCGACATCCTCGCGCT
CGCCGCCGAGATCTCCGTTGAGCTG
GTCAGTGCCACCCACTCGTTCGTTCGTCCGCAAACATGTGTGCTCTGCATCCGCGCGGCCGGCGGCCCGTTGAATTACTGCTGACACGTTAGCTA
TCTGTGATCAGGCAGGAGGGCCGTACTGGAGAGTGATGCTGGGGCGGAGGGACGCCACGACGGCAAACTTCGAAGGCGCCGACAACCTCCCCGGCCCGACGGATGCTCTGGGCGTCCTCA
GAGAGAAGTTCGCCAGCCTCGGCCTCGACGACACTGACTTCGTCGCCCTCCAAG
GTCTACAACTACGACCAAATCCCCAAATCAGTACTCCTAGTTCTATTCACATCTCACGACTGCGAG
AATTCCAAATGACATATCTGGCCATCATCTTCCAGGAGCACACACGATCGGCCGAGCGCAATGCAGGTTCGTCCAGGACAGGCTCGCCGAGCAGCCGGACCCGGCGCTGGACCGGGAGTT
CCTATCCGCCCTGCGCCAGTTCTGCCCGGCTTCGGCGGGGGTGGACGAGCGCCTGAACAACCTCGACCCGGCCACACCGGACGCCTTCGACAACAGCTACTACGTCAACATCCTACGCAA
CCGCGGCCTGCTCCGGTCCGACCAGGCGATGCTCTCGGTGCCGGACGGCGCGGCCGCCGCCACCGCGCCCATCGTCGGGCGGTTCGCTGACAGCGAAGCCGACTTCTTCCGGAGCTTCGC
AACGGCGATGATCAAGATGGGCAACATTGCGCCACTGACCGGCGACATGGGGGAGGTCAGGAGGCACTGCAGGGTGGTGAATCAAAGCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGTCTCCTTCCGCCGTTCCAGTAGCAGCGCTGAGCCTGGCCTTGTGCGCCTTGCTCGCCGCCGTGTCGAGGGCGCAGCAGCTGAGCCCTGCGTTCTACGACGGCTCGTGCCCGCAC
GTCGACGACACGGCGCGGCGCGTCATCCAGGAGGCCCGGGTCGCCGACCCGCGCATCCTCGCCAGCCTCGTCCGCCTCCAGTTCCACGACTGCTTCGTCAAT
GGCTGTGACGGGTCGTTG
CTGCTGGACGACAGCCCGGCGGTAAGAAGCGAGAAGAACGCCGCACCGAACAACAACTCGGCCCGGGGGTTCCCGGTGGTGGACGACATCAAGGCCGCCCTGGAGCACGCTTGCCCCGGC
ATCGTCTCCTGTGCCGACATCCTCGCGCTCGCCGCCGAGATCTCCGTTGAGCTG
GCAGGAGGGCCGTACTGGAGAGTGATGCTGGGGCGGAGGGACGCCACGACGGCAAACTTCGAAGGC
GCCGACAACCTCCCCGGCCCGACGGATGCTCTGGGCGTCCTCAGAGAGAAGTTCGCCAGCCTCGGCCTCGACGACACTGACTTCGTCGCCCTCCAAG
GAGCACACACGATCGGCCGAGCG
CAATGCAGGTTCGTCCAGGACAGGCTCGCCGAGCAGCCGGACCCGGCGCTGGACCGGGAGTTCCTATCCGCCCTGCGCCAGTTCTGCCCGGCTTCGGCGGGGGTGGACGAGCGCCTGAAC
AACCTCGACCCGGCCACACCGGACGCCTTCGACAACAGCTACTACGTCAACATCCTACGCAACCGCGGCCTGCTCCGGTCCGACCAGGCGATGCTCTCGGTGCCGGACGGCGCGGCCGCC
GCCACCGCGCCCATCGTCGGGCGGTTCGCTGACAGCGAAGCCGACTTCTTCCGGAGCTTCGCAACGGCGATGATCAAGATGGGCAACATTGCGCCACTGACCGGCGACATGGGGGAGGTC
AGGAGGCACTGCAGGGTGGTGAATCAAAGCTGA

Retrieve as FASTA