Entry information : BdiAPx02 (Bradi1g65820)
Entry ID 7848
Creation 2011-01-13 (Toky Ramarohetra)
Last sequence changes 2011-01-13 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-01-19 (Toky Ramarohetra (Scipio))
Peroxidase information: BdiAPx02 (Bradi1g65820)
Name (synonym) BdiAPx02 (Bradi1g65820)
Class Ascorbate peroxidase    [Orthogroup: APx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiAPx02
start..stop
S start..stop
TaAPx05 500 0 1..250 1..250
TmAPx01 496 0 1..250 1..250
HvAPx02 496 0 1..250 1..250
PamAPx01 486 2e-177 1..250 1..250
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 64746262..64746380 119 N° 2 64746016..64746190 175 N° 3 64745848..64745913 66 N° 4 64744990..64745038 49
N° 5 64744434..64744519 86 N° 6 64744271..64744350 80 N° 7 64744054..64744156 103 N° 8 64743912..64743970 59
N° 9 64743809..64743824 16  
complement(join(64743809..64743824,64743912..64743970,64744054..64744156,6474427 1..64744350,64744434..64744519,64744990..64745038,64745848..64745913,64746016..6 4746190,64746262..64746380))


exon

Literature and cross-references BdiAPx02 (Bradi1g65820)
DNA ref. Phytozome 12:   Bd1 (64746380..64743809)
Protein sequence: BdiAPx02 (Bradi1g65820)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   250
PWM (Da):   %s   27407.96  
PI (pH):   %s   6.17
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKTYPTVSAEYQEAVEKARRKLRALIAEKSCAPLMLRLAWHSAGTFDVSSKTGGPFGTMKKPAEQAHAANAGLDIAVRMLEPIKEEIPTISYADLYLAGVVAVEVSGGPEIPFHPGREDKPQPPPEGRLPDATKGSDHLRQVFGKQMGLSDQDIVALSGGHTGRCHKERSGFEGPWTREPLKFDNTYFTELLSGDKEGLLQLPSDKTLLSDPVFRPLVEKYADEKAFFEDYKEAHLRLSELGYAEA

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 7 introns), 34 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAAGACCTACCCGACCGTGAGCGCTGAGTACCAGGAGGCCGTCGAGAAGGCCAGGCGCAAGCTGCGCGCCCTCATCGCCGAGAAGAGCTGCGCCCCGCTCATGCTCCGCCTCGCG
TAAGTTCCCTCTCCTGTCCGCGCTCGTGTCGCGGGGGATTTCCGTTGTCTGATCTGAGATCGCCGCGCAGGTGGCACTCCGCTGGGACCTTCGACGTGTCGTCGAAGACCGGCGGCCCGT
TCGGTACGATGAAGAAACCGGCCGAGCAGGCGCACGCCGCCAACGCGGGGCTGGACATCGCGGTGCGGATGCTCGAGCCTATCAAGGAGGAGATCCCCACCATCTCTTACGCCGATCTCT
ACCAG
GTTCGACCCGAATACGGTTAGATCTGGTTGAACGGCCCGATCTGGTCGAATGGACGTGATTTCTGAAAAAAAAATTGCGTCTGTTTTTGTTTCTCTGTGTAGCTTGCGGGAGTTG
TCGCCGTGGAGGTGTCCGGTGGACCTGAGATCCCCTTTCACCCAGGGAGGGAG
GTGAGATTTCTCAACCTTGAAGTAGTCTCAGGGTTTTAGAGAATTTAACTCCGCAGGGGTACTGTGC
ATAGGTTGGTGATGCTGAGTTTTAAGGCTTTGTCCTGATGTGCTTTTAGTCTATGGGTTGGTTGCTCTTGGAAAAAGCGATTACATTAGTCTTTGGCCGGCGACTTTTTTTAGTTTAATA
GGACTGAGGTTTCTGGTTGTAATATTTTAGAATAGTTTGTGTTTATCATCATAAGGTATGGTTTATGTTAAGTGGTGTTTGTGTCCTGGACTGTTCGTGTTGGTTGGCCGCAAGCCCGCA
ACGTTTTTGTTGCTTGGACTTGACATGCTTACTGTCGTCCTTAAGGGTTGGATTACTGGGTTAATGTACCATAATAATTGTAATGTGACTACTTTTGATTGCATTTTTACTCCGTGATAG
GAGCAGTGGCAAGTTGATTTAATCAGTCATGATATTAGTTCTTGCTGGTTCCCACTTCGATCCAAATTAATCTGAGACTGATTTAATCTGTCATGATACAAGTTGGTTCCATGGGTAGCC
TTAATAAGAGTTCCCTGGCTCATTACTGTATTCCAGAACTTAGCAACTACTCCCTCCGATCCATAATAAGTGTCTCACACTTAGTACAACTTTGTACTAGCCGAGTACAAAATCTGACAC
ACTTATTATGGATCGGAGGGAGTAATTACAAATATTTCTGTTTTTGTGTTCTTGCAATTAAACAGAATGTGAAGTTATCACCTGATCTGTTTCGTTGTTTTTGTCTACCCAAGAACATCT
TACAATCCTATTCCTTTTCCAGGACAAGCCTCAGCCCCCACCTGAGGGTCGCCTTCCTGATGCTACCAAGGGTATCTTTCTAACCCATGCTATATTTCTTGCAATTTTTCACTAGTAACA
AATATTTATCACTATTACTAACTGCGTGGAACCCATGTACTCCCTCAGTCCCATATTAAGTGATGAAATATTACATGTATCTAGACACCTTTTGGATATAGATACATCCATATTTGGGTG
AATTTGAGTCACTTAATATGGGAATGAGGGAATGAAAAGGAATTCTTGCTTTGGTTGCTACTTATGCTGCAAAATTGATGTTCGCTCCATATAGTGTCTTGATAGTACCGCATTGTTGAA
ATGCCTTCTGCTTCTCACGAAGTATTAATTATTTCCATGTCTAGTATTGCTCTGTTCGCTCCATCATTTGATGATGCCTATATTGTTCCATTATCCTGATGGCTCAAGTTATAAGAAAGC
TCTGCTGTAGTATTGCTTTGTTCGCTCCACTCTGATGACTTTCTTTACTGTCCTCTACTAGGTTCTGACCACCTAAGGCAAGTGTTCGGCAAACAGATGGGCTTGAGTGATCAGGATATT
GTTGCCCTCTCTGGTGGTCACACCCTG
GTTAGTTTTCCTATTCTTATATGCTTCCGTAATGTACTTTGATCGCTGCGTGATGCACTAATGAAATTTTCTTGGGTTTTAAGGGAAGGTGCC
ACAAGGAGAGATCTGGCTTTGAGGGACCCTGGACTAGAGAACCTTTGAAGTTTGACAACACTTACTTCAC
GTAAGTGGGTTGAACTGGCTGTTTTTATTGTTCTTTTCTTAAACCATGTC
TAGTTAAGAACATATTATCCCATTTATTGCTGATTCGATGTCTTTAACGTACTCGTTTTCACAGGGAGCTTCTGAGTGGTGACAAAGAGGGCCTTCTTCAGCTTCCTAGTGACAAAACCC
TGCTGAGTGACCCTGTCTTCCGCCCTCTCGTGGAGAAATATGCTGCT
GTATGTCTCCTGTTGCTATCTACTAAACCAGGTTGTAGAGATATGTAAAAGTTATACAAACTTTTTTATATTC
ATTGTGGCAGGATGAGAAGGCTTTCTTTGAGGACTACAAGGAGGCACACCTCAGGCTGTCCGAACTGGGGTGAGTTGCTGTCGCATTGGTAGTATTCTCATCAGCTCGAGTGCTCGACTG
TATCTAATCATCTGTCCTTGTGAACTGTCATTACAGGTATGCTGAAGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAAGACCTACCCGACCGTGAGCGCTGAGTACCAGGAGGCCGTCGAGAAGGCCAGGCGCAAGCTGCGCGCCCTCATCGCCGAGAAGAGCTGCGCCCCGCTCATGCTCCGCCTCGCG
TGGCACTCCGCTGGGACCTTCGACGTGTCGTCGAAGACCGGCGGCCCGTTCGGTACGATGAAGAAACCGGCCGAGCAGGCGCACGCCGCCAACGCGGGGCTGGACATCGCGGTGCGGATG
CTCGAGCCTATCAAGGAGGAGATCCCCACCATCTCTTACGCCGATCTCTACCAG
CTTGCGGGAGTTGTCGCCGTGGAGGTGTCCGGTGGACCTGAGATCCCCTTTCACCCAGGGAGGGAG
GACAAGCCTCAGCCCCCACCTGAGGGTCGCCTTCCTGATGCTACCAAGGGTTCTGACCACCTAAGGCAAGTGTTCGGCAAACAGATGGGCTTGAGTGATCAGGATATTGTTGCCCTCTCT
GGTGGTCACACCCTG
GGAAGGTGCCACAAGGAGAGATCTGGCTTTGAGGGACCCTGGACTAGAGAACCTTTGAAGTTTGACAACACTTACTTCACGGAGCTTCTGAGTGGTGACAAAGAG
GGCCTTCTTCAGCTTCCTAGTGACAAAACCCTGCTGAGTGACCCTGTCTTCCGCCCTCTCGTGGAGAAATATGCTGCT
GATGAGAAGGCTTTCTTTGAGGACTACAAGGAGGCACACCTC
AGGCTGTCCGAACTGGG
GTATGCTGAAGCTTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCCAGGATCG ACGGCCAGGG GGAGCCCTCG CAGAAGCTTC CCTTCTCCCC TCCCCTGTAC CGGCGGCGTC CTTCTCAGCA TATAAACCCC CGGGGGAGCG TGGCTGCCAT TCGCCCCACA  AGCCTTGCTG TCTTCATCAG TTCTTCCATC CCTCTCCGCC TGATCCGAAG CTTTTACCTC CCAGTAGCAG CCATGGCGAA GACCTACCCG ACCGTGAGCG CTGAGTACCA GGAGGCCGTC  GAGAAGGCCA GGCGCAAGCT GCGCGCCCTC ATCGCCGAGA AGAGCTGCGC CCCGCTCATG CTCCGCCTCG CGTGGCACTC CGCTGGGACC TTCGACGTGT CGTCGAAGAC CGGCGGCCCG  TTCGGTACGA TGAAGAAACC GGCCGAGCAG GCGCACGCCG CCAACGCGGG GCTGGACATC GCGGTGCGGA TGCTCGAGCC TATCAAGGAG GAGATCCCCA CCATCTCTTA CGCCGATCTC  TACCAGCTTG CGGGAGTTGT CGCCGTGGAG GTGTCCGGTG GACCTGAGAT CCCCTTTCAC CCAGGGAGGG AGGACAAGCC TCAGCCCCCA CCTGAGGGTC GCCTTCCTGA TGCTACCAAG  GGTTCTGACC ACCTAAGGCA AGTGTTCGGC AAACAGATGG GCTTGAGTGA TCAGGATATT GTTGCCCTCT CTGGTGGTCA CACCCTGGGA AGGTGCCACA AGGAGAGATC TGGCTTTGAG  GGACCCTGGA CTAGAGAACC TTTGAAGTTT GACAACACTT ACTTCACGGA GCTTCTGAGT GGTGACAAAG AGGGCCTTCT TCAGCTTCCT AGTGACAAAA CCCTGCTGAG TGACCCTGTC  TTCCGCCCTC TCGTGGAGAA ATATGCTGCT GATGAGAAGG CTTTCTTTGA GGACTACAAG GAGGCACACC TCAGGCTGTC CGAACTGGGG TATGCTGAAG CTTAAGTGTA ATCATCTCTG  TAATAAAGTT TGTTGGCCTG AGGGCATCCC TTGTACGCTG TCAGTGGTTT CTGAGCTGTT AAGCTGAATT CAGTTGCCTT GTGCCGCAGA TCTATTGGTG TGACATCCAG TAGTGCTTTT  CAGTGTGTTC TGTGCATGAT CCGTGTTTTA ACTTCTGAAA TGCACTTGAT TTTGCCTCTT TAGCTGGTCG TTTCTTTCAG GATTATCATT TGACTCACTT TGGTTTTGCA CATCTTCATA 
AGTTTGAACC CTATGTTGTT TGGTGACAAG TATGATGGAA TGCCGTAGTG CTTGTGGTTT 

Retrieve as FASTA