Entry information : BdiPrx52 (Bradi2g09600)
Entry ID 7850
Creation 2011-01-13 (Toky Ramarohetra)
Last sequence changes 2011-01-13 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx52 (Bradi2g09600)
Name (synonym) BdiPrx52 (Bradi2g09600)
Class Class III peroxidase    [Orthogroup: Prx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx52
start..stop
S start..stop
AtaPrx03 503 0 30..342 32..339
HvPrx14 491 3e-176 30..339 51..355
BdiPrx110 491 5e-176 14..343 26..350
SiPrx07 484 2e-173 31..342 34..340
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 7895025..7895276 252 N° 2 7894178..7894957 780  
complement(join(7894178..7894957,7895025..7895276))


exon

Literature and cross-references BdiPrx52 (Bradi2g09600)
DNA ref. Phytozome 12:   Bd2 (7895276..7894178)
EST ref. GenBank:   DV473721.1 [Fragment]   DV474561.1 [Fragment]   DV475813.1 [Fragment]
Protein sequence: BdiPrx52 (Bradi2g09600)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   343 (326)
PWM (Da):   %s   37124.31 (35489.3) Transmb domain:   %s   i5-27o
PI (pH):   %s   9.58 (9.38) Peptide Signal:   %s   cut: 18 range:18-343
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARAVLALAAILALVASSCPAVSLAHRQKRQPPILARGLSLDFYRQSCPRAESIVRDFIKDAVRKDIGLAAGLLRLHFHDCFVQGCDASVLLVGSATGPQDQMGEQRAPPNLRLRPSAIRAISDIRDRLERECRGAVVSCSDILALAARDSVVVSGGPDYEVPLGRRDSPRFATMQDVIAGLPAPSSTVPALLAVLNKINLDATDLVAISGAHTVGLSPCSSFEDRLYPRQDPNMNPPFAARLRQICPAKGVNRSTVLDVSTPNAFDNRYYVNLVNREGLFVSDQDLFTNPATRPIVTRFARSQREFFEQYGVSVAKMGQINVLTGSRGQVRRNCSVRNPGTV*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, intron 1), 3 ESTs. Cultivar="Bd21-0".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCGTGCTGTGCTCGCCTTAGCGGCAATCTTGGCGTTAGTGGCTTCGAGCTGCCCTGCAGTGTCACTTGCACATCGGCAGAAGCGGCAGCCGCCGATACTGGCGCGGGGCCTGTCG
CTGGACTTCTACAGGCAGAGCTGCCCGCGGGCCGAGTCCATCGTGCGGGACTTCATCAAGGACGCCGTCCGCAAGGACATCGGCCTCGCCGCCGGACTCCTCCGCCTCCACTTCCACGAC
TGCTTCGTCCAG
GTACATTATAACCGGTGGTCGATTTGCGCATGCATGCACGGGGTATTAATTGATGCACACAATGCAGGGGTGCGACGCGTCTGTGCTGCTGGTGGGCTCGGCGACGGG
CCCACAGGACCAGATGGGGGAGCAGAGGGCGCCGCCCAACCTCAGGCTCCGGCCCTCCGCCATCAGGGCCATCAGCGACATCCGTGACCGTCTCGAGCGAGAGTGCAGGGGCGCCGTGGT
CTCCTGCTCCGACATCCTGGCCCTGGCGGCCCGCGACTCCGTGGTGGTCTCAGGCGGGCCGGACTACGAAGTCCCCCTGGGCCGGCGCGACAGCCCGCGGTTCGCCACGATGCAGGACGT
CATCGCGGGCCTGCCCGCGCCGTCCTCCACCGTGCCGGCGCTCCTGGCCGTGCTGAACAAGATCAACCTGGACGCCACCGACCTCGTCGCCATCTCCGGCGCGCACACCGTGGGGCTGTC
CCCCTGCAGCTCCTTCGAGGACCGGCTCTACCCGCGGCAGGACCCCAACATGAACCCGCCGTTCGCGGCCCGGCTCAGGCAGATCTGCCCGGCCAAGGGGGTGAACCGGAGCACCGTGCT
GGATGTGTCCACGCCCAACGCCTTCGACAACAGGTACTACGTCAACCTGGTGAACCGGGAAGGGCTCTTCGTCTCCGACCAGGACCTCTTCACCAACCCGGCCACCAGGCCCATCGTCAC
CCGCTTCGCGCGGAGCCAGCGGGAGTTCTTCGAGCAGTACGGGGTGTCTGTGGCCAAGATGGGGCAGATCAATGTGCTCACGGGCTCGCGGGGGCAGGTCCGTAGGAACTGCTCCGTCCG
CAACCCCGGCACCGTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCGTGCTGTGCTCGCCTTAGCGGCAATCTTGGCGTTAGTGGCTTCGAGCTGCCCTGCAGTGTCACTTGCACATCGGCAGAAGCGGCAGCCGCCGATACTGGCGCGGGGCCTGTCG
CTGGACTTCTACAGGCAGAGCTGCCCGCGGGCCGAGTCCATCGTGCGGGACTTCATCAAGGACGCCGTCCGCAAGGACATCGGCCTCGCCGCCGGACTCCTCCGCCTCCACTTCCACGAC
TGCTTCGTCCAG
GGGTGCGACGCGTCTGTGCTGCTGGTGGGCTCGGCGACGGGCCCACAGGACCAGATGGGGGAGCAGAGGGCGCCGCCCAACCTCAGGCTCCGGCCCTCCGCCATCAGG
GCCATCAGCGACATCCGTGACCGTCTCGAGCGAGAGTGCAGGGGCGCCGTGGTCTCCTGCTCCGACATCCTGGCCCTGGCGGCCCGCGACTCCGTGGTGGTCTCAGGCGGGCCGGACTAC
GAAGTCCCCCTGGGCCGGCGCGACAGCCCGCGGTTCGCCACGATGCAGGACGTCATCGCGGGCCTGCCCGCGCCGTCCTCCACCGTGCCGGCGCTCCTGGCCGTGCTGAACAAGATCAAC
CTGGACGCCACCGACCTCGTCGCCATCTCCGGCGCGCACACCGTGGGGCTGTCCCCCTGCAGCTCCTTCGAGGACCGGCTCTACCCGCGGCAGGACCCCAACATGAACCCGCCGTTCGCG
GCCCGGCTCAGGCAGATCTGCCCGGCCAAGGGGGTGAACCGGAGCACCGTGCTGGATGTGTCCACGCCCAACGCCTTCGACAACAGGTACTACGTCAACCTGGTGAACCGGGAAGGGCTC
TTCGTCTCCGACCAGGACCTCTTCACCAACCCGGCCACCAGGCCCATCGTCACCCGCTTCGCGCGGAGCCAGCGGGAGTTCTTCGAGCAGTACGGGGTGTCTGTGGCCAAGATGGGGCAG
ATCAATGTGCTCACGGGCTCGCGGGGGCAGGTCCGTAGGAACTGCTCCGTCCGCAACCCCGGCACCGTCTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGCACGCACA ATTAATCACG CGCGGCACGC ACTTGCATAC AAACATGCGT GCATAGCGCA TATATATACG GGGACAGCGG TAGGCAGCTA GCAGGGCAGA TCGATACAGA GTTGTGACCG  AGATGGCTCG TGCTGTGCTC GCCTTAGCGG CAATCTTGGC GTTAGTGGCT TCGAGCTGCC CTGCAGTGTC ACTTGCACAT CGGCAGAAGC GGCAGCCGCC GATACTGGCG CGGGGCCTGT  CGCTGGACTT CTACAGGCAG AGCTGCCCGC GGGCCGAGTC CATCGTGCGG GACTTCATCA AGGACGCCGT CCGCAAGGAC ATCGGCCTCG CCGCCGGACT CCTCCGCCTC CACTTCCACG  ACTGCTTCGT CCAGGGGTGC GACGCGTCTG TGCTGCTGGT GGGCTCGGCG ACGGGCCCAC AGGACCAGAT GGGGGAGCAG AGGGCGCCGC CCAACCTCAG GCTCCGGCCC TCCGCCATCA  GGGCCATCAG CGACATCCGT GACCGTCTCG AGCGAGAGTG CAGGGGCGCC GTGGTCTCCT GCTCCGACAT CCTGGCCCTG GCGGCCCGCG ACTCCGTGGT GGTCTCAGGC GGGCCGGACT  ACGAAGTCCC CCTGGGCCGG CGCGACAGCC CGCGGTTCGC CACGATGCAG GACGTCATCG CGGGCCTGCC CGCGCCGTCC TCCACCGTGC CGGCGCTCCT GGCCGTGCTG AACAAGATCA  ACCTGGACGC CACCGACCTC GTCGCCATCT CCGGCGCGCA CACCGTGGGG CTGTCCCCCT GCAGCTCCTT CGAGGACCGG CTCTACCCGC GGCAGGACCC CAACATGAAC CCGCCGTTCG  CGGCCCGGCT CAGGCAGATC TGCCCGGCCA AGGGGGTGAA CCGGAGCACC GTGCTGGATG TGTCCACGCC CAACGCCTTC GACAACAGGT ACTACGTCAA CCTGGTGAAC CGGGAAGGGC  TCTTCGTCTC CGACCAGGAC CTCTTCACCA ACCCGGCCAC CAGGCCCATC GTCACCCGCT TCGCGCGGAG CCAGCGGGAG TTCTTCGAGC AGTACGGGGT GTCTGTGGCC AAGATGGGGC  AGATCAATGT GCTCACGGGC TCGCGGGGGC AGGTCCGTAG GAACTGCTCC GTCCGCAACC CCGGCACCGT CTGAGTCTGA CTGACAGAGT TTTCGAGCTA GACTGCTCTG CTTTGCCATA  TCCTATAGCT ATTAGCTAGT AGTGGCTTCA TGGCTTGGTG GGATCATCGA GTGAGATATG AGTAGCAAGG ACTGCTGGCT GTTGATTATG TCGAAATAAA GTGATCAAGG CAAGTACTTC 
TGGATGCTTC TCTTGTCTAA AAAAAGCAAT GGTAATTGGT AAAT 

Retrieve as FASTA