Entry information : BdiPrx54 (Bradi2g09660)
Entry ID 7851
Creation 2011-01-13 (Toky Ramarohetra)
Last sequence changes 2011-01-13 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx54 (Bradi2g09660)
Name (synonym) BdiPrx54 (Bradi2g09660)
Class Class III peroxidase    [Orthogroup: Prx002]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx54
start..stop
S start..stop
BdiPrx55 658 0 1..337 1..337
HvPrx01 638 0 1..337 1..335
BdiPrx56 629 0 1..337 1..334
OsPrx03 625 0 5..337 1..334
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 7931373..7931609 237 N° 2 7930769..7930960 192 N° 3 7930068..7930652 585  
complement(join(7930068..7930652,7930769..7930960,7931373..7931609))


exon

Literature and cross-references BdiPrx54 (Bradi2g09660)
Literature Vogel,J.P., Gu,Y.Q., Twigg,P., Lazo,G.R., Laudencia-Chingcuanco,D., Hayden,D.M., Donze,T.J., Vivian,L.A., Stamova,B. and Coleman-Derr,D.
EST sequencing and phylogenetic analysis of the model grass Brachypodium distachyon.
Theor Appl Genet 113 (2), 186-195 (2006)
DNA ref. Phytozome 12:   Bd2 (7931609..7930068)
EST ref. GenBank:   DV488071.1 [3' end]
Protein sequence: BdiPrx54 (Bradi2g09660)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   337 (312)
PWM (Da):   %s   35894.3 (33460.0) Transmb domain:   %s   i7-29o
PI (pH):   %s   7.71 (7.74) Peptide Signal:   %s   cut: 26 range:26-337
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATSMGCLLVLSLVSPLLLAGAVHGNPWYGGGGLFPQFYDHSCPKAKEIVHSIVAQAVAQETRMAASLVRLHFHDCFVKGCDASVLLDNSSSIVSEKGSNPNRNSIRGFEVVDQIKVALETACPGVVSCADILALAARDSTILVGGPFWEVPLGRRDSLGASIQGSNNDIPAPNNTLPTIITKFKRLGLNIVDVVALSGAHTIGLSRCTSFRQRLYNQSGNGMADNTLDVSYAAQLRQGCPRSGGDDNLFPLDFVTPAKFDNLYFKNILAGKGLLSSDEVLLTKSAETAALVKAYADDVGLFFQHFAQSMVNMGNISPLVGAQGEIRKNCRRLNNFH*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, intron 1 and 2), 1 EST. Cultivar "bd21".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGACTTCCATGGGTTGCCTGCTGGTGCTGTCTCTTGTTTCTCCTTTGCTCCTGGCCGGCGCGGTCCACGGCAACCCGTGGTACGGCGGCGGCGGCCTGTTCCCGCAGTTCTACGAC
CACTCGTGCCCCAAGGCCAAGGAGATCGTGCATTCCATCGTGGCGCAGGCCGTCGCGCAGGAGACAAGGATGGCCGCGTCCTTGGTCAGGCTGCATTTCCATGACTGCTTCGTCAAG
GTC
CACTCTGCTTTTCCTCTCTCGTGCTCTGGTGTTCCGTTTTTTGCTTCGTAATGAAAAAATTACAGTTTACATATATTTGTAGTTTTGCACCAAAGGAAAATAACTAACTTTGCACCTTTT
GGTGATGGAAAAATTATCCTCTGGGGCATGGAAGAATCTATAGTTTAAAGGCTAGTGACTGTTTACTACTAGTAGCGATAAGACAGTGTAACCTACATTGTCCATGCATGTGAGCAGAGT
GCTATACTTCTTTTCTGCTTGCTTAACTCTTCTTCTCTCTTTCAAAGAGAGGGTGGATTTCATAATCCAAATGCACAATGATGCTGCGGTCCTGTCCATGCAAAAAAGTTCATGACACAA
AATAATAATATATCTCTCTTCTGACGACATCTTTTCACTATGATTGCAGGGGTGCGACGCGTCGGTGCTGCTAGACAACAGCAGCAGCATCGTGAGCGAGAAAGGGTCCAACCCCAACCG
CAACTCCATCAGAGGGTTCGAGGTCGTCGACCAGATCAAGGTCGCTCTCGAGACCGCCTGCCCCGGCGTCGTCTCCTGCGCCGACATCCTCGCCCTCGCCGCCCGCGACTCCACCATCCT
C
GTAAGTTAATTCCGCTAAACCGCGAGAAAGAACAAATGGTACCAAAAGAAAATGGATGCGGCCAGCTTATATATGTCCAGTTCTTAACTTGGGACCCGGCCCGAATTAACGTGCAGGTT
GGCGGCCCGTTCTGGGAAGTGCCGCTCGGGCGCAGGGACTCTCTGGGCGCCAGCATCCAGGGCTCCAACAACGACATCCCGGCGCCCAACAACACCCTCCCCACAATCATCACCAAGTTC
AAGCGCCTGGGGCTCAACATCGTGGACGTCGTGGCACTCTCAGGCGCGCACACCATCGGGCTCTCCCGGTGCACAAGCTTCAGGCAGAGGCTGTACAACCAGTCCGGCAACGGCATGGCA
GACAACACCCTGGACGTGTCCTACGCGGCACAGCTGAGGCAAGGGTGCCCTCGCTCAGGCGGCGACGACAACCTCTTCCCTCTGGACTTTGTTACCCCGGCAAAGTTCGACAACCTCTAC
TTCAAGAACATTTTGGCCGGCAAGGGGCTTCTCAGCTCGGACGAGGTCCTGCTCACCAAGAGCGCCGAGACGGCGGCGCTCGTGAAGGCGTACGCGGATGATGTGGGCCTCTTCTTCCAG
CACTTTGCGCAGTCCATGGTGAACATGGGCAACATCTCGCCGCTGGTCGGGGCGCAGGGGGAGATCAGGAAGAATTGCAGGAGGCTCAACAACTTCCACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGACTTCCATGGGTTGCCTGCTGGTGCTGTCTCTTGTTTCTCCTTTGCTCCTGGCCGGCGCGGTCCACGGCAACCCGTGGTACGGCGGCGGCGGCCTGTTCCCGCAGTTCTACGAC
CACTCGTGCCCCAAGGCCAAGGAGATCGTGCATTCCATCGTGGCGCAGGCCGTCGCGCAGGAGACAAGGATGGCCGCGTCCTTGGTCAGGCTGCATTTCCATGACTGCTTCGTCAAG
GGG
TGCGACGCGTCGGTGCTGCTAGACAACAGCAGCAGCATCGTGAGCGAGAAAGGGTCCAACCCCAACCGCAACTCCATCAGAGGGTTCGAGGTCGTCGACCAGATCAAGGTCGCTCTCGAG
ACCGCCTGCCCCGGCGTCGTCTCCTGCGCCGACATCCTCGCCCTCGCCGCCCGCGACTCCACCATCCTC
GTTGGCGGCCCGTTCTGGGAAGTGCCGCTCGGGCGCAGGGACTCTCTGGGC
GCCAGCATCCAGGGCTCCAACAACGACATCCCGGCGCCCAACAACACCCTCCCCACAATCATCACCAAGTTCAAGCGCCTGGGGCTCAACATCGTGGACGTCGTGGCACTCTCAGGCGCG
CACACCATCGGGCTCTCCCGGTGCACAAGCTTCAGGCAGAGGCTGTACAACCAGTCCGGCAACGGCATGGCAGACAACACCCTGGACGTGTCCTACGCGGCACAGCTGAGGCAAGGGTGC
CCTCGCTCAGGCGGCGACGACAACCTCTTCCCTCTGGACTTTGTTACCCCGGCAAAGTTCGACAACCTCTACTTCAAGAACATTTTGGCCGGCAAGGGGCTTCTCAGCTCGGACGAGGTC
CTGCTCACCAAGAGCGCCGAGACGGCGGCGCTCGTGAAGGCGTACGCGGATGATGTGGGCCTCTTCTTCCAGCACTTTGCGCAGTCCATGGTGAACATGGGCAACATCTCGCCGCTGGTC
GGGGCGCAGGGGGAGATCAGGAAGAATTGCAGGAGGCTCAACAACTTCCACTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGACTT CCATGGGTTG CCTGCTGGTG CTGTCTCTTG TTTCTCCTTT GCTCCTGGCC GGCGCGGTCC ACGGCAACCC GTGGTACGGC GGCGGCGGCC TGTTCCCGCA GTTCTACGAC  CACTCGTGCC CCAAGGCCAA GGAGATCGTG CATTCCATCG TGGCGCAGGC CGTCGCGCAG GAGACAAGGA TGGCCGCGTC CTTGGTCAGG CTGCATTTCC ATGACTGCTT CGTCAAGGGG  TGCGACGCGT CGGTGCTGCT AGACAACAGC AGCAGCATCG TGAGCGAGAA AGGGTCCAAC CCCAACCGCA ACTCCATCAG AGGGTTCGAG GTCGTCGACC AGATCAAGGT CGCTCTCGAG  ACCGCCTGCC CCGGCGTCGT CTCCTGCGCC GACATCCTCG CCCTCGCCGC CCGCGACTCC ACCATCCTCG TTGGCGGCCC GTTCTGGGAA GTGCCGCTCG GGCGCAGGGA CTCTCTGGGC  GCCAGCATCC AGGGCTCCAA CAACGACATC CCGGCGCCCA ACAACACCCT CCCCACAATC ATCACCAAGT TCAAGCGCCT GGGGCTCAAC ATCGTGGACG TCGTGGCACT CTCAGGCGCG  CACACCATCG GGCTCTCCCG GTGCACAAGC TTCAGGCAGA GGCTGTACAA CCAGTCCGGC AACGGCATGG CAGACAACAC CCTGGACGTG TCCTACGCGG CACAGCTGAG GCAAGGGTGC  CCTCGCTCAG GCGGCGACGA CAACCTCTTC CCTCTGGACT TTGTTACCCC GGCAAAGTTC GACAACCTCT ACTTCAAGAA CATTTTGGCC GGCAAGGGGC TTCTCAGCTC GGACGAGGTC  CTGCTCACCA AGAGCGCCGA GACGGCGGCG CTCGTGAAGG CGTACGCGGA TGATGTGGGC CTCTTCTTCC AGCACTTTGC GCAGTCCATG GTGAACATGG GCAACATCTC GCCGCTGGTC  GGGGCGCAGG GGGAGATCAG GAAGAATTGC AGGAGGCTCA ACAACTTCCA CTGATGAGTT ATTTATATGT TCAAGTGTAC TCGTGTGTGG AGTGGTTGGT GGTGCCGGGT TTTGTTTAAA  TAAGCAAAGC GTACGTGGTT GTAATCTGGG AGGCCCAGAT GGTGTTTTGT TTTCGAATTC ACAAAGATAT TTGTTCAATG TAATGGGGAA AGTCTGTGGC ACGTCGCGTT CGAATTTGTA 
GCGACCAGTT TGCTTTGAAC GTGGTTGGAT ATTTTTTTTG GTAAATGAAG AATTTT 

Retrieve as FASTA