Entry information : BdiPrx55 (Bradi2g09680)
Entry ID 7852
Creation 2011-01-13 (Toky Ramarohetra)
Last sequence changes 2011-01-13 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx55 (Bradi2g09680)
Name (synonym) BdiPrx55 (Bradi2g09680)
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer Abiotic stress
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx55
start..stop
S start..stop
BdiPrx54 635 0 1..337 1..337
BdiPrx56 634 0 1..337 1..334
OsPrx03 630 0 5..337 1..334
HvPrx01 629 0 1..337 1..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 7952888..7953124 237 N° 2 7953745..7953936 192 N° 3 7954044..7954628 585  
join(7952888..7953124,7953745..7953936,7954044..7954628)


exon

Literature and cross-references BdiPrx55 (Bradi2g09680)
Literature Lucas,S., Rokhsar,D., Wang,M., Lindquist,E.A., Fox,S.E., Vogel,J., Bragg,J.N., McKenzie,N., Bevan,M.W., Garvin,D., Michael,T., Hazen
,S., Chang,J., Laudencia-Chingcuanco,D., Weng,Y. and Mockler,T.
DOE Joint Genome Institute Brachypodium distachyon EST project.
Unpublished (2009).
DNA ref. Phytozome 12:   Bd2 (7952888..7954628)
EST ref. GenBank:   DV488157.1 [5' end]   GT769417.1 [3' end]   GT769418.1 [3' end]
Protein sequence: BdiPrx55 (Bradi2g09680)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   337 (312)
PWM (Da):   %s   35769.14 (33376.9) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.1 (8.21) Peptide Signal:   %s   cut: 26 range:26-337
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASMGCLLVLCLVSPLLLAGAAHGNPWYGGGGLFPQFYDHSCPKAKEIVQSIVAQAVAQETRMAASLVRLHFHDCFVKGCDASVLLDNSSSIVSEKGSNPNRNSLRGFEVVDQIKATLEAACPGTVSCADILALAARDSTILVGGPFWDVPLGRRDSLGASIQGSNNGIPAPNNTLPTIITKFKRLGLHVVDVVALSGAHTIGLSRCTSFRQRLYNQSGNGMADNTLDVSYAAQLRQGCPRSGGDNNLFPLDVVTPAKFDNLYFKNILAGKGLLSSDEVLLTKSAETAALVKAYADDVGLFFQHFAQSMVNMGNIMPLTGSQGEVRKNCRRLNNYH*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, intron 1 and 2), 3 ESTs. Strain="Bd21".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCTTCCATGGGTTGCCTCCTGGTGCTCTGCCTTGTTTCTCCTTTGCTCCTCGCCGGCGCCGCCCACGGCAACCCGTGGTACGGCGGCGGCGGCCTGTTCCCGCAGTTCTACGAC
CACTCGTGCCCCAAGGCCAAGGAGATCGTGCAATCCATCGTGGCGCAGGCCGTCGCGCAGGAGACCAGGATGGCCGCGTCCTTGGTCAGACTGCATTTCCATGACTGCTTCGTCAAG
GTC
CACTCTGCTTCCTCTCTGCTACTTTGCTTACTCATGTTTTCATAGATATATGACGTGCATATATTTTGTTTGGTAACTTTAGCTGTCCGGACTTTCGAACGTAATTGAGCGCGCAAAGTT
TGGACCTTTAAACGTTTCCAATATTTGCGCCTTGCTATCTGAAAAAGGTGTCGCTAGGAGCATGGGAGAATCTCTAGTTTTTTAGGCTAACTGTTTAGCCGTGACGAGATAGCCTACCTA
CGTTGCCCGGCCATGTGAGCACTGCGCTTTTTGTGTCCATGACAAGATCGAACCCGTACCATGAATCCATGATTGCTTAATTCCTTTTTTTTTTCAAAGAGAGGGTGATTGCCTATAATT
CATCTTTTTTTCCAAAGAGAGCTATAAAGGGTGATAGCCAGATTCATTTTTTTTTCAAAGAGAGGGTGATTGCTTCATTCAGATCAATGTTCAGTTAATAATTGGTCCTTTCGATCCGTC
AAAAAGATAATAATTGGTCCTGTCTCTTCAATGTTAAACTGAACTGCATGTGCCCCTAATCTATCCGCTATTGCAATGCGGCTAATCTAACCACCGACCCTTTTTCCTGATCTTTTCTTC
TTGGTGAATACGTGCAGGGTTGTGACGCGTCCGTGCTGCTGGACAACAGCAGCAGCATAGTGAGCGAGAAGGGGTCCAACCCAAACCGCAACTCTCTGAGGGGATTCGAGGTCGTGGACC
AGATCAAGGCCACCCTCGAGGCCGCCTGCCCCGGCACCGTCTCCTGCGCCGACATCCTCGCCCTCGCTGCCCGCGACTCCACCATCCTC
GTAAGTAGAACCACCCGTAATTCTAGCTGTT
CCTACCAGCTAAACAATGTACCATCTGGGAACTGGGAACTCTGGTTTCTTATTTGGGACTCAAAAATAACGTGCAGGTTGGTGGCCCGTTCTGGGACGTGCCGCTGGGCCGGAGGGACTC
TCTGGGCGCCAGCATCCAGGGCTCCAACAACGGCATCCCGGCGCCCAACAACACACTCCCCACAATCATCACCAAGTTCAAGCGCCTGGGGCTCCATGTCGTGGACGTCGTGGCACTCTC
AGGCGCGCACACCATCGGCCTGTCCCGGTGCACCAGCTTCAGGCAGAGGCTGTACAACCAGTCCGGCAACGGCATGGCCGACAACACCCTGGACGTCTCCTACGCGGCACAGCTGAGGCA
AGGGTGCCCTCGCTCAGGCGGCGACAACAACCTCTTCCCGCTGGACGTCGTCACCCCGGCAAAGTTCGACAACCTCTACTTCAAGAACATTTTGGCCGGCAAGGGGCTTCTCAGCTCAGA
CGAAGTCCTGCTCACCAAGAGCGCCGAGACGGCGGCGCTGGTGAAGGCGTACGCGGATGATGTGGGTCTCTTCTTCCAGCACTTTGCGCAGTCGATGGTGAACATGGGCAACATCATGCC
ACTGACAGGGTCGCAAGGGGAGGTCAGGAAGAACTGCAGGAGGCTCAACAACTATCACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCTTCCATGGGTTGCCTCCTGGTGCTCTGCCTTGTTTCTCCTTTGCTCCTCGCCGGCGCCGCCCACGGCAACCCGTGGTACGGCGGCGGCGGCCTGTTCCCGCAGTTCTACGAC
CACTCGTGCCCCAAGGCCAAGGAGATCGTGCAATCCATCGTGGCGCAGGCCGTCGCGCAGGAGACCAGGATGGCCGCGTCCTTGGTCAGACTGCATTTCCATGACTGCTTCGTCAAG
GGT
TGTGACGCGTCCGTGCTGCTGGACAACAGCAGCAGCATAGTGAGCGAGAAGGGGTCCAACCCAAACCGCAACTCTCTGAGGGGATTCGAGGTCGTGGACCAGATCAAGGCCACCCTCGAG
GCCGCCTGCCCCGGCACCGTCTCCTGCGCCGACATCCTCGCCCTCGCTGCCCGCGACTCCACCATCCTC
GTTGGTGGCCCGTTCTGGGACGTGCCGCTGGGCCGGAGGGACTCTCTGGGC
GCCAGCATCCAGGGCTCCAACAACGGCATCCCGGCGCCCAACAACACACTCCCCACAATCATCACCAAGTTCAAGCGCCTGGGGCTCCATGTCGTGGACGTCGTGGCACTCTCAGGCGCG
CACACCATCGGCCTGTCCCGGTGCACCAGCTTCAGGCAGAGGCTGTACAACCAGTCCGGCAACGGCATGGCCGACAACACCCTGGACGTCTCCTACGCGGCACAGCTGAGGCAAGGGTGC
CCTCGCTCAGGCGGCGACAACAACCTCTTCCCGCTGGACGTCGTCACCCCGGCAAAGTTCGACAACCTCTACTTCAAGAACATTTTGGCCGGCAAGGGGCTTCTCAGCTCAGACGAAGTC
CTGCTCACCAAGAGCGCCGAGACGGCGGCGCTGGTGAAGGCGTACGCGGATGATGTGGGTCTCTTCTTCCAGCACTTTGCGCAGTCGATGGTGAACATGGGCAACATCATGCCACTGACA
GGGTCGCAAGGGGAGGTCAGGAAGAACTGCAGGAGGCTCAACAACTATCACTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAACAAGAGA AATACAGATC CATCTCTTCT CTGATCACAC CCAGCATCAT AAGTACTGCA GGGGGACAGT GTAGCTTTTC TTTCCTAGCT ACTAGCTAGC TCGATCCATG GCGGCTTCCA  TGGGTTGCCT CCTGGTGCTC TGCCTTGTTT CTCCTTTGCT CCTCGCCGGC GCCGCCCACG GCAACCCGTG GTACGGCGGC GGCGGCCTGT TCCCGCAGTT CTACGACCAC TCGTGCCCCA  AGGCCAAGGA GATCGTGCAA TCCATCGTGG CGCAGGCCGT CGCGCAGGAG ACCAGGATGG CCGCGTCCTT GGTCAGACTG CATTTCCATG ACTGCTTCGT CAAGGGTTGT GACGCGTCCG  TGCTGCTGGA CAACAGCAGC AGCATAGTGA GCGAGAAGGG GTCCAACCCA AACCGCAACT CTCTGAGGGG ATTCGAGGTC GTGGACCAGA TCAAGGCCAC CCTCGAGGCC GCCTGCCCCG  GCACCGTCTC CTGCGCCGAC ATCCTCGCCC TCGCTGCCCG CGACTCCACC ATCCTCGTTG GTGGCCCGTT CTGGGACGTG CCGCTGGGCC GGAGGGACTC TCTGGGCGCC AGCATCCAGG  GCTCCAACAA CGGCATCCCG GCGCCCAACA ACACACTCCC CACAATCATC ACCAAGTTCA AGCGCCTGGG GCTCCATGTC GTGGACGTCG TGGCACTCTC AGGCGCGCAC ACCATCGGCC  TGTCCCGGTG CACCAGCTTC AGGCAGAGGC TGTACAACCA GTCCGGCAAC GGCATGGCCG ACAACACCCT GGACGTCTCC TACGCGGCAC AGCTGAGGCA AGGGTGCCCT CGCTCAGGCG  GCGACAACAA CCTCTTCCCG CTGGACGTCG TCACCCCGGC AAAGTTCGAC AACCTCTACT TCAAGAACAT TTTGGCCGGC AAGGGGCTTC TCAGCTCAGA CGAAGTCCTG CTCACCAAGA  GCGCCGAGAC GGCGGCGCTG GTGAAGGCGT ACGCGGATGA TGTGGGTCTC TTCTTCCAGC ACTTTGCGCA GTCGATGGTG AACATGGGCA ACATCATGCC ACTGACAGGG TCGCAAGGGG  AGGTCAGGAA GAACTGCAGG AGGCTCAACA ACTATCACTG AGCAGCCCGT TACTGAAAAG CTCCATGCTT TAATTTGTGT GCTGAATTGT ACTGCGTGGA GTTGGTGGCT TCTTTATTTT  ATTTTGGAAT AAACAATGTG TGTGCTTGTG TTATTTATTC ATATTGGTTC AGTGAGCTCC AACTTCCAAA TCGTGCACTG GTCGGTCCTT CAGAAGAAGA AGAAAAAAAT GACACTTTAA 
AACTTTGAGA AACAAATAGT ATTACAAAAA TGTTACTAAA TGATTCTGCA ATAAAATGCA AA 

Retrieve as FASTA