Entry information : BdiPrx57 (Bradi2g10150)
Entry ID 7853
Creation 2011-01-13 (Toky Ramarohetra)
Last sequence changes 2011-01-13 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx57 (Bradi2g10150)
Name (synonym) BdiPrx57 (Bradi2g10150)
Class Class III peroxidase    [Orthogroup: Prx014]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx57
start..stop
S start..stop
HvPrx143 546 0 6..345 4..337
TaPrx19 539 0 6..345 4..338
SiPrx11 471 4e-168 27..342 35..341
ZmPrx84 468 6e-167 25..343 31..341
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 8340452..8340721 270 N° 2 8341541..8342308 768  
join(8340452..8340721,8341541..8342308)


exon

Literature and cross-references BdiPrx57 (Bradi2g10150)
DNA ref. Phytozome 11:   Bd2 (8340452..8342308)
EST ref. GenBank:   DV471833.1 [Fragment]
Protein sequence: BdiPrx57 (Bradi2g10150)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   345
PWM (Da):   %s   35959.12 Transmb domain:   %s   i13-32o
PI (pH):   %s   8.63
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGRQQQSVCGGAGWWWRAVAWWGAVVLGHLVSHGRAGLLDTNPGLAYNFYRTSCPNAESIVQRVTWAQVAANQALPGRLLRLHFHDCFVKGCDASILLDTAGSEKTAGPNLSVGGYEVIDAVKAQLEQACPGVVSCADVVALAARDAVSYQFKASLWQVETGRRDGPVSSAGNTGSLPSPSAGFGGLVQSFAAKGLDVGDLVALSGAHTIGKASCSSVTPRLYNGNATTVDPLLDSAYAKRLITSCPNPNLTPASPPPASTVDLDAATPFKFDGTYYSNLLNKQGVLASDAALTQNAAAAAMVANLTNSINFYAAFAMSMKKMGRVDVLTLKNGQGKIRTQCRVP*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, intron 1), 2 ESTs. Cultivar="Bd21".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGAGGCAGCAGCAATCAGTGTGCGGAGGAGCAGGGTGGTGGTGGCGAGCAGTGGCGTGGTGGGGGGCCGTGGTCCTCGGCCATTTAGTGAGCCATGGCAGGGCCGGGCTCCTGGAC
ACCAACCCGGGCCTGGCCTATAACTTCTACCGGACGTCGTGCCCCAACGCCGAGTCCATCGTCCAGAGAGTCACCTGGGCGCAGGTCGCCGCCAACCAAGCCCTCCCCGGCAGGCTCCTC
CGCCTCCACTTCCACGACTGCTTCGTCAAG
GTCTGTCCGTTAAGCTCGCCTTTCAGTTTCTGTCTTTTTCTTGCTATTACGGGTAGTGTCTGGGTGGTGGGCTCTGCTCCAGCTCTTGCG
TTGATTGAACGAACCTTTCCCCTTTCCGTCGGCAACGGTGTTCCAGCCGGCCGACGGGGATGTCTTTCTTCTCCCGGCAAGGAATTAACTACGGGTTCCATTTCTAGCTAGCTACATTGA
TGCTCGAATCTTGATAGCCTGCCTCCTCGCCGGTCTAATTAAACTTGCACGGCATACGGGGGTCGCCTTTCTGCTTCCGGTGAAGTGAACTGGAGCAGATTTTTACCGCTTGGGGGAGGC
TAGTTTTTATCGGTGCTCAAGCAGAAACGGATAACATATCTGTCACTCACTCACTCGGTCATCCGTTCACTGAATTGAGAGTCCCTTTATGCGTACGTAAGCATTACGGCACCTTTCCGC
CCGTATCGCGCAAGCTGTACGCGGTAGCGACACACCCAAGCAAGCAAGCAAACAAAACTGAAAAAAAGTAAAGCTAGAGCAGTACAAAGGGGAGCAAAGCGAATCTTGGCATATTTTCCG
TGCGCGGTGCGGCCAATGCTTCGCCGCTCACATGCGCGCCGAGCCGAGCGAGCACTCGCACACCCAGCTGATGGATGGCTGCTCTGCCGCGCCGGTACGGTACGGCGGCCACAGCCCACA
GCAGCAGCAGCTTTATTAATTTGGCCTCTTGCGCGGGCGGCGATTGCGCCGAAATTTGAAATTTCAAACCCCGAAAAATCTGCTTGCGGTGGTTGGTGGCTGACAGCTGATTGTGTTCCC
GTGCTGCAGGGGTGTGACGCGTCGATCCTGCTGGACACGGCGGGGAGCGAGAAGACGGCGGGGCCGAACCTCTCCGTGGGCGGCTACGAGGTGATCGACGCCGTGAAGGCGCAGCTCGAG
CAAGCCTGCCCGGGCGTCGTCTCCTGCGCCGACGTGGTCGCGCTCGCGGCCCGCGACGCCGTCTCGTACCAGTTCAAGGCGTCTCTCTGGCAGGTGGAAACCGGCCGGAGAGACGGGCCC
GTCTCTTCCGCGGGCAACACGGGCTCCCTCCCTTCCCCGTCCGCGGGCTTCGGGGGCCTCGTGCAGAGCTTCGCCGCCAAGGGGCTCGACGTGGGCGACCTCGTGGCGCTCTCGGGCGCG
CACACCATCGGCAAGGCCAGCTGCTCCAGCGTCACGCCCCGGCTGTACAACGGCAACGCCACCACCGTCGACCCGCTGCTGGATTCCGCCTACGCCAAGAGGCTCATCACCTCGTGCCCG
AACCCGAACCTGACGCCGGCCTCGCCGCCGCCGGCGTCCACGGTGGATTTGGACGCCGCCACGCCGTTCAAGTTCGACGGCACGTACTACAGCAACCTGCTGAACAAGCAGGGGGTGCTC
GCCTCTGACGCCGCGCTCACGCAGAACGCCGCCGCGGCCGCCATGGTCGCCAACCTCACCAACTCCATCAATTTCTACGCCGCCTTCGCCATGTCCATGAAGAAGATGGGCCGCGTCGAC
GTGCTCACCCTCAAGAACGGACAGGGGAAGATCAGGACGCAGTGCCGTGTGCCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGAGGCAGCAGCAATCAGTGTGCGGAGGAGCAGGGTGGTGGTGGCGAGCAGTGGCGTGGTGGGGGGCCGTGGTCCTCGGCCATTTAGTGAGCCATGGCAGGGCCGGGCTCCTGGAC
ACCAACCCGGGCCTGGCCTATAACTTCTACCGGACGTCGTGCCCCAACGCCGAGTCCATCGTCCAGAGAGTCACCTGGGCGCAGGTCGCCGCCAACCAAGCCCTCCCCGGCAGGCTCCTC
CGCCTCCACTTCCACGACTGCTTCGTCAAG
GGGTGTGACGCGTCGATCCTGCTGGACACGGCGGGGAGCGAGAAGACGGCGGGGCCGAACCTCTCCGTGGGCGGCTACGAGGTGATCGAC
GCCGTGAAGGCGCAGCTCGAGCAAGCCTGCCCGGGCGTCGTCTCCTGCGCCGACGTGGTCGCGCTCGCGGCCCGCGACGCCGTCTCGTACCAGTTCAAGGCGTCTCTCTGGCAGGTGGAA
ACCGGCCGGAGAGACGGGCCCGTCTCTTCCGCGGGCAACACGGGCTCCCTCCCTTCCCCGTCCGCGGGCTTCGGGGGCCTCGTGCAGAGCTTCGCCGCCAAGGGGCTCGACGTGGGCGAC
CTCGTGGCGCTCTCGGGCGCGCACACCATCGGCAAGGCCAGCTGCTCCAGCGTCACGCCCCGGCTGTACAACGGCAACGCCACCACCGTCGACCCGCTGCTGGATTCCGCCTACGCCAAG
AGGCTCATCACCTCGTGCCCGAACCCGAACCTGACGCCGGCCTCGCCGCCGCCGGCGTCCACGGTGGATTTGGACGCCGCCACGCCGTTCAAGTTCGACGGCACGTACTACAGCAACCTG
CTGAACAAGCAGGGGGTGCTCGCCTCTGACGCCGCGCTCACGCAGAACGCCGCCGCGGCCGCCATGGTCGCCAACCTCACCAACTCCATCAATTTCTACGCCGCCTTCGCCATGTCCATG
AAGAAGATGGGCCGCGTCGACGTGCTCACCCTCAAGAACGGACAGGGGAAGATCAGGACGCAGTGCCGTGTGCCGTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTACTGT CATCACAAAA CACAAACACA GAGCATCCTC CTTGGCTCCT TCTCTCTCAC TCACTCCCTC GGTTCCCCAT CCCGGCTTCT CTGAAGACCG GTGCTGCTCT GAAACTGGAG  AGTTAAGAAG AGAGAGAGAG ATGGGGAGGC AGCAGCAATC AGTGTGCGGA GGAGCAGGGT GGTGGTGGCG AGCAGTGGCG TGGTGGGGGG CCGTGGTCCT CGGCCATTTA GTGAGCCATG  GCAGGGCCGG GCTCCTGGAC ACCAACCCGG GCCTGGCCTA TAACTTCTAC CGGACGTCGT GCCCCAACGC CGAGTCCATC GTCCAGAGAG TCACCTGGGC GCAGGTCGCC GCCAACCAAG  CCCTCCCCGG CAGGCTCCTC CGCCTCCACT TCCACGACTG CTTCGTCAAG GGGTGTGACG CGTCGATCCT GCTGGACACG GCGGGGAGCG AGAAGACGGC GGGGCCGAAC CTCTCCGTGG  GCGGCTACGA GGTGATCGAC GCCGTGAAGG CGCAGCTCGA GCAAGCCTGC CCGGGCGTCG TCTCCTGCGC CGACGTGGTC GCGCTCGCGG CCCGCGACGC CGTCTCGTAC CAGTTCAAGG  CGTCTCTCTG GCAGGTGGAA ACCGGCCGGA GAGACGGGCC CGTCTCTTCC GCGGGCAACA CGGGCTCCCT CCCTTCCCCG TCCGCGGGCT TCGGGGGCCT CGTGCAGAGC TTCGCCGCCA  AGGGGCTCGA CGTGGGCGAC CTCGTGGCGC TCTCGGGCGC GCACACCATC GGCAAGGCCA GCTGCTCCAG CGTCACGCCC CGGCTGTACA ACGGCAACGC CACCACCGTC GACCCGCTGC  TGGATTCCGC CTACGCCAAG AGGCTCATCA CCTCGTGCCC GAACCCGAAC CTGACGCCGG CCTCGCCGCC GCCGGCGTCC ACGGTGGATT TGGACGCCGC CACGCCGTTC AAGTTCGACG  GCACGTACTA CAGCAACCTG CTGAACAAGC AGGGGGTGCT CGCCTCTGAC GCCGCGCTCA CGCAGAACGC CGCCGCGGCC GCCATGGTCG CCAACCTCAC CAACTCCATC AATTTCTACG  CCGCCTTCGC CATGTCCATG AAGAAGATGG GCCGCGTCGA CGTGCTCACC CTCAAGAACG GACAGGGGAA GATCAGGACG CAGTGCCGTG TGCCGTGATA GTCACAGATT CTTTTTTTTT  CTTGGCGCTC GTTTTTTTTT CCTTCTCTCT CTTCTTGTTC CGGGCGCGGA TCAAATATAT TGTGCGCCGT GATTAAGTTC CCAATATATC TTATATTGGT TTTGTTGAGT CCGAGCTGTA 
ATACTGTCCA CCGATGGCTT CCGTTGCATA CCTCTTGCAG 

Retrieve as FASTA