Entry information : BdiPrx59 (Bradi2g11300)
Entry ID 7854
Creation 2011-01-13 (Toky Ramarohetra)
Last sequence changes 2011-01-13 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx59 (Bradi2g11300)
Name (synonym) BdiPrx59 (Bradi2g11300)
Class Class III peroxidase    [Orthogroup: Prx070]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx59
start..stop
S start..stop
BdiPrx60 499 6e-180 7..324 6..321
OsiPrx07 394 2e-138 1..324 1..317
OsPrx07 381 7e-134 1..324 1..308
OsPrx101 381 1e-133 1..324 1..316
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 9584024..9584233 210 N° 2 9582412..9583176 765  
complement(join(9582412..9583176,9584024..9584233))


exon

Literature and cross-references BdiPrx59 (Bradi2g11300)
DNA ref. Phytozome 12:   Bd2 (9584233..9582412)
Protein sequence: BdiPrx59 (Bradi2g11300)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (301)
PWM (Da):   %s   34357.3 (31880.9)  
PI (pH):   %s   7.63 (6.73) Peptide Signal:   %s   cut: 24 range:24-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKLTCLRLLMVSVLATLLTMSSADLQYDFYNSSCPNAETTIRNVVYSQIDANPSVAAALIRLLFHDCFVRGCDASILLDPSSANPSPEKSVIPLAQAGYQAVDQIKAAVEAVCPGKVSCADIIAFAARDSVNKSAGFSYAVPAGRRDGSVSTDFSLLTNMPSPSFGIADLVGSFKRKNLDVDDLVTLSGAHTIGVSHCSSFTNRLYPSVDPAMDAGYAADLKVPCPAPPGRGVPDNLVNNSAVITTPMTFDNQFYKNALARRVLFTSDAALMTRNDTVAKVTENAADLAAWKVRFAASMVKMGNIEVLTGTQGQVRKYCRAIGS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, intron 1). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTGACATGCCTGCGGCTGCTCATGGTGTCCGTCCTGGCTACTCTCCTCACGATGTCATCTGCAGATCTGCAGTACGACTTCTACAACTCGTCGTGCCCAAACGCCGAGACAACG
ATCAGGAATGTCGTCTATAGCCAGATCGACGCCAACCCTAGTGTCGCTGCAGCCTTAATTCGCCTGCTGTTCCATGATTGCTTTGTCAGG
GTATGAAATGACATTTTAGTAATTTTATTT
ATATACTTCTTTGTTTGTTTATTTATCATTTTGAACATTATAATATACTCTAACTCTTCGTTCTAAAATATAAGACGTACTTTCTCCTTTTCATAATATAAGATGTATTTCGTGTGCATT
GACCAAACTTTTGAGTAAGTATTACTGCATCAACGTGAGATATGTGATACAAATCATAACCATAAACAAATACCCTGAATATGGATATAATGATATTAATTTTATAAGTGATAACCATAG
AGAAATTTGAAAAGGAGATAGTGGTAACCGTAGATACAAGTCAAAAAAAATACATGTCATAAATAAATACTTATGTGATACAAGTCATAACCATAGAGAGATTTTTGGTCAAAGGATAAG
TCAAAAAAATAGGCCTTATATTTTGAAATGGAGAGAGTCTACTTATGTTGACTAACAAACTTTCTTAAATTTGATCATATTTAGAACACAAAATATCAACAACTACCGTCTCATATAGGA
TCATTAGATTACTTGTAAGATATATTTTCATTGTATCTTGATTTAAAAAAGTATATATGTTGATATCTTTTGCAATAAGTTTGGTCGAATTTTATATATTTTTTAACGGATCTTTTTTTT
TTGAGTAATTTCCTACAAAGCTTGAAAGAAATATATAATTGAGAGCACCGTTAGCTCACGCTTGCTTTGGGACTATTTATCTCCGTTTACTCACTCTACTGCAAAACGCGCGTACTCCAT
ACAAGCAGAGTCTACATTTAATAGGAGTAGCATCTTTTTTCAACGAAAGAGAGGAAGAATTGTTTTGCTTCGACCTATAACAGCTTTGCATTAATAGGGCTGCGACGCCTCCATACTCCT
GGACCCCTCCAGTGCCAACCCATCGCCGGAGAAGTCAGTCATCCCCCTAGCCCAAGCCGGGTATCAGGCCGTGGACCAGATCAAGGCGGCTGTCGAGGCCGTGTGCCCCGGGAAGGTCTC
CTGCGCCGACATCATCGCCTTCGCCGCCCGCGACTCGGTCAACAAATCCGCCGGCTTCTCCTACGCCGTCCCCGCAGGCAGGCGCGACGGCAGCGTGTCCACGGATTTCTCCCTCCTCAC
CAACATGCCGTCTCCTTCCTTCGGCATCGCGGATCTCGTGGGAAGTTTCAAGCGCAAGAACCTCGACGTGGACGACCTCGTGACACTCTCCGGGGCGCACACCATTGGCGTGTCGCACTG
CTCCAGCTTCACTAACCGGTTGTACCCGAGCGTGGACCCGGCCATGGACGCCGGCTACGCGGCGGACCTGAAGGTCCCGTGTCCGGCGCCGCCGGGGCGCGGCGTGCCGGACAACCTGGT
GAACAACAGCGCGGTGATCACGACGCCCATGACGTTTGACAACCAGTTCTACAAGAACGCGCTCGCCAGGCGAGTGCTCTTCACGTCGGACGCGGCGCTGATGACCCGCAACGACACGGT
GGCGAAGGTGACGGAGAACGCTGCCGACCTGGCGGCGTGGAAAGTGCGGTTCGCGGCGTCCATGGTTAAGATGGGGAACATCGAGGTGCTCACGGGGACGCAGGGACAGGTCCGGAAGTA
CTGCCGCGCCATAGGCAGCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTGACATGCCTGCGGCTGCTCATGGTGTCCGTCCTGGCTACTCTCCTCACGATGTCATCTGCAGATCTGCAGTACGACTTCTACAACTCGTCGTGCCCAAACGCCGAGACAACG
ATCAGGAATGTCGTCTATAGCCAGATCGACGCCAACCCTAGTGTCGCTGCAGCCTTAATTCGCCTGCTGTTCCATGATTGCTTTGTCAGG
GGCTGCGACGCCTCCATACTCCTGGACCCC
TCCAGTGCCAACCCATCGCCGGAGAAGTCAGTCATCCCCCTAGCCCAAGCCGGGTATCAGGCCGTGGACCAGATCAAGGCGGCTGTCGAGGCCGTGTGCCCCGGGAAGGTCTCCTGCGCC
GACATCATCGCCTTCGCCGCCCGCGACTCGGTCAACAAATCCGCCGGCTTCTCCTACGCCGTCCCCGCAGGCAGGCGCGACGGCAGCGTGTCCACGGATTTCTCCCTCCTCACCAACATG
CCGTCTCCTTCCTTCGGCATCGCGGATCTCGTGGGAAGTTTCAAGCGCAAGAACCTCGACGTGGACGACCTCGTGACACTCTCCGGGGCGCACACCATTGGCGTGTCGCACTGCTCCAGC
TTCACTAACCGGTTGTACCCGAGCGTGGACCCGGCCATGGACGCCGGCTACGCGGCGGACCTGAAGGTCCCGTGTCCGGCGCCGCCGGGGCGCGGCGTGCCGGACAACCTGGTGAACAAC
AGCGCGGTGATCACGACGCCCATGACGTTTGACAACCAGTTCTACAAGAACGCGCTCGCCAGGCGAGTGCTCTTCACGTCGGACGCGGCGCTGATGACCCGCAACGACACGGTGGCGAAG
GTGACGGAGAACGCTGCCGACCTGGCGGCGTGGAAAGTGCGGTTCGCGGCGTCCATGGTTAAGATGGGGAACATCGAGGTGCTCACGGGGACGCAGGGACAGGTCCGGAAGTACTGCCGC
GCCATAGGCAGCTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTGA CATGCCTGCG GCTGCTCATG GTGTCCGTCC TGGCTACTCT CCTCACGATG TCATCTGCAG ATCTGCAGTA CGACTTCTAC AACTCGTCGT GCCCAAACGC CGAGACAACG  ATCAGGAATG TCGTCTATAG CCAGATCGAC GCCAACCCTA GTGTCGCTGC AGCCTTAATT CGCCTGCTGT TCCATGATTG CTTTGTCAGG GGCTGCGACG CCTCCATACT CCTGGACCCC  TCCAGTGCCA ACCCATCGCC GGAGAAGTCA GTCATCCCCC TAGCCCAAGC CGGGTATCAG GCCGTGGACC AGATCAAGGC GGCTGTCGAG GCCGTGTGCC CCGGGAAGGT CTCCTGCGCC  GACATCATCG CCTTCGCCGC CCGCGACTCG GTCAACAAAT CCGCCGGCTT CTCCTACGCC GTCCCCGCAG GCAGGCGCGA CGGCAGCGTG TCCACGGATT TCTCCCTCCT CACCAACATG  CCGTCTCCTT CCTTCGGCAT CGCGGATCTC GTGGGAAGTT TCAAGCGCAA GAACCTCGAC GTGGACGACC TCGTGACACT CTCCGGGGCG CACACCATTG GCGTGTCGCA CTGCTCCAGC  TTCACTAACC GGTTGTACCC GAGCGTGGAC CCGGCCATGG ACGCCGGCTA CGCGGCGGAC CTGAAGGTCC CGTGTCCGGC GCCGCCGGGG CGCGGCGTGC CGGACAACCT GGTGAACAAC  AGCGCGGTGA TCACGACGCC CATGACGTTT GACAACCAGT TCTACAAGAA CGCGCTCGCC AGGCGAGTGC TCTTCACGTC GGACGCGGCG CTGATGACCC GCAACGACAC GGTGGCGAAG  GTGACGGAGA ACGCTGCCGA CCTGGCGGCG TGGAAAGTGC GGTTCGCGGC GTCCATGGTT AAGATGGGGA ACATCGAGGT GCTCACGGGG ACGCAGGGAC AGGTCCGGAA GTACTGCCGC 
GCCATAGGCA GCTAATTAAA ACATTACTGT GCACGAATTA ATATACGCGA GGCAAAGCCT GGTCTACCTT TTGCTGATAA TATTTTTGTA TGTCTTTTGC TGATAATGTT TTTTTAT 

Retrieve as FASTA