Entry information : BdiPrx61 (Bradi2g11320)
Entry ID 7855
Creation 2011-01-13 (Toky Ramarohetra)
Last sequence changes 2011-01-13 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx61 (Bradi2g11320)
Name (synonym) BdiPrx61 (Bradi2g11320)
Class Class III peroxidase    [Orthogroup: Prx079]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue types Callus
Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx61
start..stop
S start..stop
TaPrx68 613 0 1..346 1..344
HvPrx43 600 0 1..344 1..342
ZmPrx107 578 0 1..346 1..347
ZmPrx44 570 0 1..346 1..347
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 9593193..9593411 219 N° 2 9592200..9593027 828  
complement(join(9592200..9593027,9593193..9593411))


exon

Literature and cross-references BdiPrx61 (Bradi2g11320)
Literature Vogel,J.P., Gu,Y.Q., Twigg,P., Lazo,G.R., Laudencia-Chingcuanco,D., Hayden,D.M., Donze,T.J., Vivian,L.A., Stamova,B. and Coleman-Derr,D. EST sequencing and phylogenetic analysis of the model grass Brachypodium distachyon. Theor Appl Genet 113 (2), 186-195 (2006).
DNA ref. Phytozome 12:   Bd2 (9593411..9592200)
EST ref. GenBank:   DV471311.1 [5' end]   DV486992.1 [3' end]
Protein sequence: BdiPrx61 (Bradi2g11320)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   348 (323)
PWM (Da):   %s   37675.24 (35170.8)  
PI (pH):   %s   6.64 (6.64) Peptide Signal:   %s   cut: 26 range:26-348
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRLSVALLCALVAIQAALLVAPSEAGELQVGYYDKKCRGVENVVKWHIIKALKVNRRTGAALVRLLFHDCFVRGCDGSVLLDASAENPHPEKEAAVNIGLAAFDLLEEIKAAVEHRCPGVVSCSDILIYAARDAASILSNGNIHFDVSAGRLDGLVSSAHEAQQELPDSTMTVQQLIDNFARKDFDVEELVILSGAHSIGVGHCSSFTGRLAAPAQQIDPAYRGLLNYKCAGHGNGNPAVVNNVRDEDYEAVAKFMPGFTSRVRKISDFLDNSYYHNNLARIVTFNSDWQLLTQKEALGHVREYAENATLWDGDFSESLLKLSKLPMPAGSKGGIRKKCSIVSHTLPY*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 1 intron). 3 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGCTCTCGGTGGCTCTCCTGTGCGCCCTGGTGGCCATCCAGGCGGCGCTCCTTGTCGCGCCGTCGGAGGCCGGCGAGTTGCAGGTCGGGTACTACGACAAGAAATGCAGGGGCGTG
GAGAACGTCGTCAAGTGGCACATCATCAAGGCCCTCAAGGTGAACCGCCGCACCGGCGCCGCCCTCGTCCGCCTCCTCTTCCACGACTGCTTCGTCAGG
GTATATGCACATTCTTTTGGC
CTTTGGGTTCTACTGATACACCTGCACGCAAGTTAATTATACCGTGGGCGCATGGCTTGTGGCAATTATTATGCGTTTATTTATTAGTTAAGCCAAAACCTCAAAAGCGATGAGTACTGA
CTTTGTAACCTGCATTGCATGCAGGGGTGCGATGGCTCTGTCCTCCTTGACGCGTCCGCGGAGAACCCTCACCCAGAGAAGGAGGCCGCGGTGAACATCGGGCTAGCCGCCTTCGACCTC
CTGGAGGAGATCAAGGCGGCCGTGGAGCACAGATGCCCCGGCGTGGTGTCCTGCTCGGACATCCTCATCTACGCGGCCCGCGACGCGGCCAGCATCCTCAGCAACGGGAACATCCACTTC
GACGTCTCCGCGGGCCGCCTCGACGGGCTCGTCTCCTCGGCCCACGAGGCCCAGCAGGAGCTCCCGGACTCCACCATGACCGTGCAGCAGCTCATCGACAACTTCGCCCGCAAGGACTTC
GACGTGGAGGAGCTCGTCATCCTGTCCGGCGCGCACTCCATCGGCGTGGGCCACTGCTCCTCCTTCACGGGCCGCCTCGCCGCGCCGGCCCAGCAGATCGACCCGGCCTACCGCGGCCTG
CTCAACTACAAGTGCGCCGGCCATGGCAATGGCAACCCGGCCGTGGTCAACAACGTCCGCGACGAGGACTACGAGGCCGTGGCCAAGTTCATGCCGGGGTTCACCAGCCGGGTGAGGAAG
ATCAGCGACTTCCTGGACAACAGCTACTACCACAACAACCTTGCCAGGATCGTCACCTTCAACTCCGACTGGCAGCTGCTCACGCAGAAGGAGGCGCTGGGCCACGTCCGCGAGTACGCT
GAGAACGCCACGCTCTGGGACGGGGACTTCTCCGAGTCGCTGCTCAAGCTCAGCAAGCTGCCCATGCCGGCCGGGAGCAAGGGCGGGATCAGGAAGAAGTGCAGCATTGTCAGCCACACG
CTGCCGTACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGCTCTCGGTGGCTCTCCTGTGCGCCCTGGTGGCCATCCAGGCGGCGCTCCTTGTCGCGCCGTCGGAGGCCGGCGAGTTGCAGGTCGGGTACTACGACAAGAAATGCAGGGGCGTG
GAGAACGTCGTCAAGTGGCACATCATCAAGGCCCTCAAGGTGAACCGCCGCACCGGCGCCGCCCTCGTCCGCCTCCTCTTCCACGACTGCTTCGTCAGG
GGGTGCGATGGCTCTGTCCTC
CTTGACGCGTCCGCGGAGAACCCTCACCCAGAGAAGGAGGCCGCGGTGAACATCGGGCTAGCCGCCTTCGACCTCCTGGAGGAGATCAAGGCGGCCGTGGAGCACAGATGCCCCGGCGTG
GTGTCCTGCTCGGACATCCTCATCTACGCGGCCCGCGACGCGGCCAGCATCCTCAGCAACGGGAACATCCACTTCGACGTCTCCGCGGGCCGCCTCGACGGGCTCGTCTCCTCGGCCCAC
GAGGCCCAGCAGGAGCTCCCGGACTCCACCATGACCGTGCAGCAGCTCATCGACAACTTCGCCCGCAAGGACTTCGACGTGGAGGAGCTCGTCATCCTGTCCGGCGCGCACTCCATCGGC
GTGGGCCACTGCTCCTCCTTCACGGGCCGCCTCGCCGCGCCGGCCCAGCAGATCGACCCGGCCTACCGCGGCCTGCTCAACTACAAGTGCGCCGGCCATGGCAATGGCAACCCGGCCGTG
GTCAACAACGTCCGCGACGAGGACTACGAGGCCGTGGCCAAGTTCATGCCGGGGTTCACCAGCCGGGTGAGGAAGATCAGCGACTTCCTGGACAACAGCTACTACCACAACAACCTTGCC
AGGATCGTCACCTTCAACTCCGACTGGCAGCTGCTCACGCAGAAGGAGGCGCTGGGCCACGTCCGCGAGTACGCTGAGAACGCCACGCTCTGGGACGGGGACTTCTCCGAGTCGCTGCTC
AAGCTCAGCAAGCTGCCCATGCCGGCCGGGAGCAAGGGCGGGATCAGGAAGAAGTGCAGCATTGTCAGCCACACGCTGCCGTACTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCACATCACA CCACAAAGCA GCTAACAAGC AGAGCTTAGC TAAGCTTCTC TCCGATCAAC AAGCTAAGCT AGATAGGTCG CGGCGTAGTT TAGTCGCGCC GATCGAAAGT AGGATCAACG  AGGACATGAG GCTCTCGGTG GCTCTCCTGT GCGCCCTGGT GGCCATCCAG GCGGCGCTCC TTGTCGCGCC GTCGGAGGCC GGCGAGTTGC AGGTCGGGTA CTACGACAAG AAATGCAGGG  GCGTGGAGAA CGTCGTCAAG TGGCACATCA TCAAGGCCCT CAAGGTGAAC CGCCGCACCG GCGCCGCCCT CGTCCGCCTC CTCTTCCACG ACTGCTTCGT CAGGGGGTGC GATGGCTCTG  TCCTCCTTGA CGCGTCCGCG GAGAACCCTC ACCCAGAGAA GGAGGCCGCG GTGAACATCG GGCTAGCCGC CTTCGACCTC CTGGAGGAGA TCAAGGCGGC CGTGGAGCAC AGATGCCCCG  GCGTGGTGTC CTGCTCGGAC ATCCTCATCT ACGCGGCCCG CGACGCGGCC AGCATCCTCA GCAACGGGAA CATCCACTTC GACGTCTCCG CGGGCCGCCT CGACGGGCTC GTCTCCTCGG  CCCACGAGGC CCAGCAGGAG CTCCCGGACT CCACCATGAC CGTGCAGCAG CTCATCGACA ACTTCGCCCG CAAGGACTTC GACGTGGAGG AGCTCGTCAT CCTGTCCGGC GCGCACTCCA  TCGGCGTGGG CCACTGCTCC TCCTTCACGG GCCGCCTCGC CGCGCCGGCC CAGCAGATCG ACCCGGCCTA CCGCGGCCTG CTCAACTACA AGTGCGCCGG CCATGGCAAT GGCAACCCGG  CCGTGGTCAA CAACGTCCGC GACGAGGACT ACGAGGCCGT GGCCAAGTTC ATGCCGGGGT TCACCAGCCG GGTGAGGAAG ATCAGCGACT TCCTGGACAA CAGCTACTAC CACAACAACC  TTGCCAGGAT CGTCACCTTC AACTCCGACT GGCAGCTGCT CACGCAGAAG GAGGCGCTGG GCCACGTCCG CGAGTACGCT GAGAACGCCA CGCTCTGGGA CGGGGACTTC TCCGAGTCGC  TGCTCAAGCT CAGCAAGCTG CCCATGCCGG CCGGGAGCAA GGGCGGGATC AGGAAGAAGT GCAGCATTGT CAGCCACACG CTGCCGTACT GATAAATCGT AGAGTACGTG CAGGGTGGCG  GGACGGCGGG CGAGAGATGG ATTCATGGAA AAAAGGAGCC TGTTGCGTGT GTGGACTAGC TTGGAGTTCA ATAATGTCGT GGATTGATTG CTTTGTCGAC GCTCTATCCA TTCTTTTGAT 
TCCCATTGGT TGTACTTAAC TTGTGTGTTT CTGATCAGCT CTTTTAATTT GTTCTACATA ATTATAAATG TATATTTGCA ATAAAGCTAT ACGTTCTTGC AACTTATTGG 

Retrieve as FASTA