Entry information : BdiPrx62 (Bradi2g12170)
Entry ID 7856
Creation 2011-01-13 (Toky Ramarohetra)
Last sequence changes 2011-01-13 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-29 (Qiang Li)
Peroxidase information: BdiPrx62 (Bradi2g12170)
Name (synonym) BdiPrx62 (Bradi2g12170)
Class Class III peroxidase    [Orthogroup: Prx087]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue types Callus
Roots
Sheaths
Stems
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx62
start..stop
S start..stop
HvPrx10 549 0 1..330 1..330
SbPrx60 503 2e-180 9..356 19..371
SiPrx05 498 2e-178 20..356 26..359
ZmPrx01_lineC 483 2e-172 16..355 23..367
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 10504108..10504323 216 N° 2 10504756..10505193 438 N° 3 10505289..10505705 417  
join(10504108..10504323,10504756..10505193,10505289..10505705)


exon

Literature and cross-references BdiPrx62 (Bradi2g12170)
Literature Vogel,J.P., Gu,Y.Q., Twigg,P., Lazo,G.R., Laudencia-Chingcuanco,D., Hayden,D.M., Donze,T.J., Vivian,L.A., Stamova,B. and Coleman-Derr,D. EST sequencing and phylogenetic analysis of the model grass Brachypodium distachyon. Theor Appl Genet 113 (2), 186-195 (2006).
DNA ref. Phytozome 12:   Bd2 (10504108..10505705)
EST ref. GenBank:   DV471876.1 [5' end]
Protein sequence: BdiPrx62 (Bradi2g12170)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   356 (331)
PWM (Da):   %s   37698.12 (35369.9)  
PI (pH):   %s   7.89 (7.92) Peptide Signal:   %s   cut: 26 range:26-356
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATPHGTAALALAAVLCLLPALASAQLKVGFYQKTCPNAETLVRQAVSAAFAKNAGIAAGLIRLHFHDCFVRGCDASVLLTVNPGGGRTERDAPPNNPSLRGFEVIDAAKAAVEQSCPSTVSCADILAFAARDSVTLTGNVFYPVPAGRRDGSVSKELDANANLPPPTFTAQQLIDRFKNKSLNAEEMVLLSGAHTVGRSFCASFVDRVWKNGTNTPIVDAGLSPSYAALLRALCPFNTTQTTPITTAMDPGTLNVLDNNYYKLLPRGMGLFFSDNQLRVDANLNAMVNRFAANETLWKERFAAAMVKMGRIQVQTGRCGQVRLNCSVVNPSSSSSIELPSLSLADEEQEGVVATS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, introns 1 and 3') and 7 ESTs. Containing IntR (3').
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACGCCACACGGCACGGCGGCTCTAGCCCTCGCCGCGGTGCTGTGCCTGCTGCCGGCGCTGGCCAGCGCCCAGCTCAAGGTCGGGTTCTACCAGAAGACCTGCCCCAACGCCGAG
ACGCTTGTCCGGCAGGCCGTCTCGGCGGCCTTTGCCAAGAACGCCGGCATCGCCGCCGGGCTCATCCGCCTCCATTTCCATGACTGCTTCGTCAGG
GTACGTACCTAGCGCATGCATTTC
ACACGATTGAGATAAATTGCTCCATGTTTTGGGCTTGTTTGTTTACCAGTGCGAATTTTAGTATCTGCTTGATGTAATTAACGCCAGGATATACATATCGATCTTAGTTCGATCCCGTAC
TCTGTAAGGTAGCCGGTTCGTCAGTAGTACTGCAGTACTGAAATTTGAGAGAACAAATGCAAAATGAGAAAAGGTATAGCAAAGTGATTTATATTCCTATCTATCAAGACAAAGAAAAAG
AAGAAGAAAGCACACAAAATAAAGCTCGCGAAATACGAAAGTGATTTATAGCAAAGTGATTTATATGCCCTGCCCTGCTCTTTTCTCTGTAGCTTCGGTCGGAGGGAATGCATGTTCCCT
GGTGCTTGCAAAAGGTGACAGAGTAGTACTAAGGAAATCTCTCTGCAGGGCTGCGACGCGTCGGTGCTGCTGACCGTGAACCCGGGCGGCGGCAGGACGGAGCGGGACGCCCCGCCGAAC
AACCCGAGCCTCCGTGGCTTCGAGGTGATCGACGCCGCCAAGGCGGCCGTGGAGCAGAGCTGCCCCAGCACGGTCTCCTGCGCCGACATCCTCGCCTTCGCGGCCCGCGACAGCGTCACG
CTCACCGGCAACGTCTTCTACCCCGTCCCCGCCGGCCGCCGCGACGGCTCCGTCTCCAAAGAATTGGACGCCAACGCCAACCTGCCCCCGCCCACATTCACCGCGCAGCAGCTCATCGAC
CGCTTCAAGAACAAGTCCCTCAACGCCGAGGAGATGGTGCTCCTCTCCGGCGCCCACACCGTCGGCCGCTCCTTCTGCGCCTCCTTCGTCGACCGCGTCTGGAAGAACGGCACCAACACC
CCCATC
GTACGTTACGAGATCTAGCCCGTCATACATGTTGAATAATCGATCCGGACTGACGAATGAATGTGTGCGTGTGGGGTGTTTGATGAAATGACTAGGTGGACGCGGGGCTGAGCC
CGTCGTACGCGGCGCTGCTGAGGGCGCTGTGCCCGTTTAACACGACGCAGACGACGCCCATCACCACGGCCATGGACCCCGGCACGCTCAACGTGCTGGACAACAACTACTACAAGCTGC
TGCCGCGGGGGATGGGGCTCTTCTTCTCCGACAACCAGCTGCGGGTGGACGCCAACCTCAACGCCATGGTGAACAGGTTCGCGGCCAACGAGACCCTGTGGAAGGAGCGGTTCGCGGCGG
CCATGGTGAAGATGGGCCGCATCCAGGTGCAGACGGGAAGGTGCGGACAGGTTCGGCTCAACTGCAGCGTCGTCAATCCCTCCTCCTCGTCGTCGATCGAGCTGCCGTCACTCTCCCTCG
CCGACGAGGAGCAGGAGGGCGTCGTCGCTACCAGCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACGCCACACGGCACGGCGGCTCTAGCCCTCGCCGCGGTGCTGTGCCTGCTGCCGGCGCTGGCCAGCGCCCAGCTCAAGGTCGGGTTCTACCAGAAGACCTGCCCCAACGCCGAG
ACGCTTGTCCGGCAGGCCGTCTCGGCGGCCTTTGCCAAGAACGCCGGCATCGCCGCCGGGCTCATCCGCCTCCATTTCCATGACTGCTTCGTCAGG
GGCTGCGACGCGTCGGTGCTGCTG
ACCGTGAACCCGGGCGGCGGCAGGACGGAGCGGGACGCCCCGCCGAACAACCCGAGCCTCCGTGGCTTCGAGGTGATCGACGCCGCCAAGGCGGCCGTGGAGCAGAGCTGCCCCAGCACG
GTCTCCTGCGCCGACATCCTCGCCTTCGCGGCCCGCGACAGCGTCACGCTCACCGGCAACGTCTTCTACCCCGTCCCCGCCGGCCGCCGCGACGGCTCCGTCTCCAAAGAATTGGACGCC
AACGCCAACCTGCCCCCGCCCACATTCACCGCGCAGCAGCTCATCGACCGCTTCAAGAACAAGTCCCTCAACGCCGAGGAGATGGTGCTCCTCTCCGGCGCCCACACCGTCGGCCGCTCC
TTCTGCGCCTCCTTCGTCGACCGCGTCTGGAAGAACGGCACCAACACCCCCATC
GTGGACGCGGGGCTGAGCCCGTCGTACGCGGCGCTGCTGAGGGCGCTGTGCCCGTTTAACACGACG
CAGACGACGCCCATCACCACGGCCATGGACCCCGGCACGCTCAACGTGCTGGACAACAACTACTACAAGCTGCTGCCGCGGGGGATGGGGCTCTTCTTCTCCGACAACCAGCTGCGGGTG
GACGCCAACCTCAACGCCATGGTGAACAGGTTCGCGGCCAACGAGACCCTGTGGAAGGAGCGGTTCGCGGCGGCCATGGTGAAGATGGGCCGCATCCAGGTGCAGACGGGAAGGTGCGGA
CAGGTTCGGCTCAACTGCAGCGTCGTCAATCCCTCCTCCTCGTCGTCGATCGAGCTGCCGTCACTCTCCCTCGCCGACGAGGAGCAGGAGGGCGTCGTCGCTACCAGCTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GACCGCAGAG CTAGCCAACC TCAAAATACC ATCATTAGTT GGAGATCTCA GTCTAGTTGT GTAGACTTGT GCGAGAGATC GAAATGGCTA CGCCACACGG CACGGCGGCT CTAGCCCTCG  CCGCGGTGCT GTGCCTGCTG CCGGCGCTGG CCAGCGCCCA GCTCAAGGTC GGGTTCTACC AGAAGACCTG CCCCAACGCC GAGACGCTTG TCCGGCAGGC CGTCTCGGCG GCCTTTGCCA  AGAACGCCGG CATCGCCGCC GGGCTCATCC GCCTCCATTT CCATGACTGC TTCGTCAGGG GCTGCGACGC GTCGGTGCTG CTGACCGTGA ACCCGGGCGG CGGCAGGACG GAGCGGGACG  CCCCGCCGAA CAACCCGAGC CTCCGTGGCT TCGAGGTGAT CGACGCCGCC AAGGCGGCCG TGGAGCAGAG CTGCCCCAGC ACGGTCTCCT GCGCCGACAT CCTCGCCTTC GCGGCCCGCG  ACAGCGTCAC GCTCACCGGC AACGTCTTCT ACCCCGTCCC CGCCGGCCGC CGCGACGGCT CCGTCTCCAA AGAATTGGAC GCCAACGCCA ACCTGCCCCC GCCCACATTC ACCGCGCAGC  AGCTCATCGA CCGCTTCAAG AACAAGTCCC TCAACGCCGA GGAGATGGTG CTCCTCTCCG GCGCCCACAC CGTCGGCCGC TCCTTCTGCG CCTCCTTCGT CGACCGCGTC TGGAAGAACG  GCACCAACAC CCCCATCGTG GACGCGGGGC TGAGCCCGTC GTACGCGGCG CTGCTGAGGG CGCTGTGCCC GTTTAACACG ACGCAGACGA CGCCCATCAC CACGGCCATG GACCCCGGCA  CGCTCAACGT GCTGGACAAC AACTACTACA AGCTGCTGCC GCGGGGGATG GGGCTCTTCT TCTCCGACAA CCAGCTGCGG GTGGACGCCA ACCTCAACGC CATGGTGAAC AGGTTCGCGG  CCAACGAGAC CCTGTGGAAG GAGCGGTTCG CGGCGGCCAT GGTGAAGATG GGCCGCATCC AGGTGCAGAC GGGAAGGTGC GGACAGGTTC GGCTCAACTG CAGCGTCGTC AATCCCTCCT  CCTCGTCGTC GATCGAGCTG CCGTCACTCT CCCTCGCCGA CGAGGAGCAG GAGGGCGTCG TCGCTACCAG CTAGGGATCT AAGATCGGAC CCAGCGACTG TTACATGTGT TTGCTTGTGT  TTTGCTTACT TTTGACGCTG AGATCCCGTT AGTGCACTTT TACGTGGTGT GTGCCGGCCG GCATGCGCGC TTTATATTGG ATTTTGGCAT TGCGTAATAA TAAGTGCGTA TCAGTTTTAT  GCTGCGTGTT TCAATATCTT CACTGCGCTG AGAAGTGAAT CAGGATTATT TCAGGACCGG CGCCCTCAGA TGCCAGATCA CGCGAGCCTA CGCCCCAAGA TTTTGGCGCC GTGGAAATAT 
TGGTTGGCCT GAGCGCCGCT TGTTGGCGGT TGTCTCTTGG CGGGTTTCAA ATTTCAGAAA CAGAAAATTT GCATACCCTA GTACCA 

Retrieve as FASTA