Entry information : BdiPrx68 (Bradi2g13190)
Entry ID 7858
Creation 2011-01-13 (Toky Ramarohetra)
Last sequence changes 2011-01-13 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-29 (Qiang Li)
Peroxidase information: BdiPrx68 (Bradi2g13190)
Name (synonym) BdiPrx68 (Bradi2g13190)
Class Class III peroxidase    [Orthogroup: Prx014]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx68
start..stop
S start..stop
TaPrx05-1A 593 0 5..338 12..343
OsPrx1617 560 0 4..338 7..342
MePrx127 388 5e-136 33..337 26..324
AcoPrx32 388 7e-136 29..338 23..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11627991..11628224 234 N° 2 11627537..11627891 355 N° 3 11624429..11624553 125 N° 4 11624004..11624306 303
complement(join(11624004..11624306,11624429..11624553,11627537..11627891,1162799 1..11628224))


exon

Literature and cross-references BdiPrx68 (Bradi2g13190)
DNA ref. Phytozome 11:   Bd2 (11628224..11624004)
Protein sequence: BdiPrx68 (Bradi2g13190)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   338 (316)
PWM (Da):   %s   35921.14 (33782.0) Transmb domain:   %s   i7-29o
PI (pH):   %s   7.93 (7.31) Peptide Signal:   %s   cut: 29 range:23-338
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKGNKQLGCLVAVAVLVLSAGSLDTAAAQAAGLKKGFYKKSCPQAEDIAQKVVWNRVAGNRELAAKFLRMFFHDCFVRGCDASVLLDSPTRTAEKDSAPNLSLAGFEVIDEVKAALERACPGVVSCADIVALAARDSVSFQYGKKLWEVETGRRDGSISSDQQALDEIPAPSSTFDVLASNFSSKGLGVQDLVVLSGGHTIGIGNCNLVSSRIFNFTGKNNPSDIDPSLNPPYAKFLQGQCRRNQADPNDNTTVVPMDTGSSTSFDSHYFVNLKAGQGLFTSDATLVTNARAASLVDKLQDNGVFLDHFKNSIKRMGQIGVLTGANGQIRNRCNVVNS

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, introns 1, 3 and 3'). No ESTs. Containing IntR (3').
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGGGTAATAAGCAGCTGGGATGCCTGGTTGCCGTGGCAGTATTGGTCTTGTCCGCCGGAAGCCTGGACACTGCGGCAGCGCAGGCGGCCGGGCTGAAGAAGGGGTTCTACAAGAAG
AGCTGCCCTCAGGCGGAGGACATCGCGCAGAAGGTGGTGTGGAACCGCGTCGCCGGCAACCGCGAGCTCGCCGCCAAGTTCCTCCGCATGTTCTTCCATGACTGCTTCGTCAGG
GTACGT
ATACAATGCTAATCTCAAGTCAAAATATATCGCCGATTCATAATAAGTGTGTCTCAGACTGTTGCTTTTGTTACGCGCGGCTTAATGTGGCAGGGGTGTGACGCGTCGGTGCTTCTGGAC
TCGCCGACGAGGACGGCGGAGAAGGACTCGGCGCCGAACCTGTCGCTGGCGGGGTTCGAGGTGATCGACGAGGTGAAGGCGGCGCTGGAGCGGGCGTGCCCGGGCGTCGTCTCCTGCGCC
GACATCGTCGCGCTCGCCGCACGGGACTCCGTGTCTTTCCAGTACGGCAAGAAGCTGTGGGAGGTGGAGACCGGACGCCGCGACGGCTCGATCTCGAGCGACCAGCAGGCGCTGGACGAG
ATCCCGGCGCCGTCCTCCACCTTCGACGTCCTCGCCTCCAACTTCTCCAGCAAGGGCCTCGGCGTCCAGGACCTCGTCGTCCTCTCAG
GTACGTATACTCCGTCAACCCACACTTCATTG
TACTGTCTAGCTAGCTAATTTTGCAGTTGATGCATGCTTGCCGCTTGCGCTAATTTAATTTGCTCCTTTAGTGTGTGTGGCGCTAGCTTAGCGTTTGTCGGTACGCTGTGAGTGTGGACC
ACGGTCGTTGTGGTTACTGCTGAATCGTAGAGAAACAACGAAAGGAACAACGCCGCGTGGGCGCCGTGGGACGAGCCACGCGCAGCGCACGTCGGTCCCTGCGTTTGATAGGTTGCAGCA
GGAATTTTACGCTGTAGCGCTGTCCATTGCTACCATACGGTGTGTTAAATGTGGCATGGCAGACCACAGAGACATAATGGGCGAGCGCCCAGCAGTTACCAACCTGCAAACCAAGAACTC
AAACTAACTATGTCAAAATTACAAATGGGAAATGACAAATTTTTGTTACGGTGAAATTATGACAAACGTTTTTTCCACTCTATTTTGTTGATATAGAATGCCCATCCTAAGTCTTCTACA
TGCTAGGTCATAGAATCCTATACATCGTAAAAATAAATCATACGTCCTCCGTATGATTTAGGAACGGAGGGAGTACATAAAAGGATTCTACGTATGTATCGCAACGCTGAATACTCTGTT
CTCAGATGCCGGGCGTTGCTTAATTTAGACCTTGCACCTATGCACCGGAGCACGTTATATGAAGAGCCTTGTACAAAACAGTGGTCAGTACGAGAGTCTTATGTGCATTTGCGTTGGCGA
ACGTTTTTAGACTTGAGTATCACTAGTACGCACTACGTAACTGAAACTGTGCTCGTACAAACCAGAACGCAGATATGTATGTACTCCTTTCATTACTAAATACTCGTCGTTACACTAAAA
CAACGAAAAGTATTTAGAAATAGAGGGAGTACTTGCAACACATGCACGTCACGTACAGTTGCATGAAACATGTCAACTTAAGTCTCATCTGAAAGTGGTGCGACTGTCGGTGACCGATTC
GTTTACCCCCGCTAACTACCTCTTTGATACTCGTGTTCTAGTCTAGGTAACGTAGCTCTCCGATCAAACCCAACTGATTGGTTGCAACTGCATGCAGGACACGTTAGCTTGCCTCTTGTC
ATCATAAACTACGGATTCCTCCTTTATGATGATAGATATGTATTTCTGAACCGGCTGATTTGATTGCAACTGTAAGGCACGTTAGCTTGCCTCTTGCATTTAGGGCTATTCGTTGACAAG
CAGAGGTTGTACAGCTGCTGAATAATGCGACCGTTGGAGCAAATGCGATATGACTGATAAGTACATAGAAGGTTAATGCAAAATTCTTTTACAGAAGATTAAAAAAAGAACATAAAGTGA
AATCCCGCATGCATTTAAAACATACAGCGTTGAACAACCAAGTTGTTGGCAGGGCGGACCTAATTGAAGCAGCGTAAATTTTACTACTATTGATATCATATCCTCTTGTACTTTTAGCAA
AATAATATTCTCTCCGTCCAACAAAACATGTCTCAAGTTTGTTAATATTTGAATGTATCTAAACATGATTTAGTGAATAGATGTATTTAAATTTAGTTAAAGTTAAGACATCTTTTGTCG
AATCGAGGAGTACTGAATTTTCTATCATGTGAAAGACTAGGCTTTGAATATATATGTCTATCATGTGAAGTGCGGTGTCCTCTATCATAGGACAGTTGGGGCCGGCAATTCTATCTCGGT
TAGAAATACAACTTTTCCACGACTTTCCATCTTCCGAACTTCTATCCGATGGCTCAGGAAGAGGAAGGTCACGTGTTGGGACACAAGGAGAAAGCAAAGTGAAGAAAACAGGACCAAACT
CTGCTTAACTGGTTGAAATTAATGATCTGAAAACGACAGAGTTCCCTACTTGAAAAAGGACAAAAAAGGGCAACCGTTCCTACACTAGGAGGTTGCTGCGCTAGTTAGTACGGACTACGC
AGAGAGCCCGTGTCGGCATGAACCATTACGACGGAGTGCCGGAGTGGTGGCCTATGAACATAGCAATGTATAGCACAGGTGTGTTTGTACAGCACATTTAATTTGCTTTCACCCACTCGG
AGCCGTGAAAAGAAAAGAGTGAATTCCATTTTTGACCTCAAGTTTTGATTTTTTGACAGCTTTGACCCGTTTAGTGGAATTTTCGTTTTTTTATCCCATTTAGCCGAACTTGTGCCACCA
ATGATCTCATTTAAGACTTTTGTCCAAATCCCGTCCCGCTGACGATCCCCTGCGATCTCAGGATCGACTACTTTGATGGAGTACTCCAGCTCGAACTTGGTCTCACGACTCTCAACTCGC
CAGCCCACTGAGTGCTCAAGCCGCAGGCGGTGGAGTACTGTGGTGTCACCGCTGCTCTACTCCTCCTGCTGTTCCTCGCCGGCGGCGTTCGCGGTGTTCGTGCTGGTGGTGTGGGCGGTG
GTGCTCACGGCCAACTCATTCTTGCTTTTCGTGAGGCGTCAGCTCCTTTGCGCCGTACATCGCCAGGATGTCCCTCGTGTCCCCGCCGCTGACGGGGGTTCTATTCCTCTTCTATGGCTT
GTTGTGTGCTGCTGCCGCTAGCTAGCTGCTGCCTGCGTGTTGTGCCGCTATGCTGCTGCTGCCTGCTTGTGGTGCCGCCACTGCTGCTTGGCGAAGGAGCAGAGGCGGGCAAGCCGAGCC
GGCTGCAGAGGCTCCTCTGCTCTTCGGGCCAAGCTAGGCCGGCAGCCAGCTCATGGTGAGCTTTGCCTGAATCCACCCTGACCTGTTAGGACGGAAGAGATTTGGGCAAAACTCTTACAT
GGGGTCAACGGTGGCACAAGTTCCGCTAAATGTGGTAAAAAAAAGGAAAATTTCACTAACTGGGGTCAAAGCTGTAAAAAAAATGAAACTTGAGTGTCAAAAATGGAATCCACTCATAAG
AAAAAGACAGAAAAAGACCGCTTAACTGAATTGAACCTTTTTTGGACATGTCATGTGCAAACACACTGCAGGCGGACATACCATCGGAATAGGAAACTGCAACCTCGTCAGCTCCAGGAT
CTTCAACTTCACCGGCAAAAACAACCCCAGCGACATCGATCCTTCCCTCAACCCACCCTACGCCAAGTTCCTCCAG
GTACCTATATATCTCTCTTCAGTCAGCATTCCTTAATCTTGTCA
TAATAATGGATGGAATAATACTCAGCGGCGGGGTGCCTAATCGTATTAGTATACGGATATGGGATTGTGCGCGCGCAGGGGCAGTGCAGGCGTAACCAGGCGGACCCGAACGACAACACG
ACGGTGGTGCCCATGGACACCGGCAGCAGCACCTCCTTCGACAGCCACTACTTCGTCAACCTTAAAGCCGGGCAGGGGCTCTTCACCTCCGACGCCACGCTGGTCACCAACGCCCGCGCA
GCCTCCCTCGTCGACAAGCTGCAGGACAATGGCGTCTTCCTCGACCACTTCAAGAACTCCATCAAGCGCATGGGCCAGATCGGGGTGCTCACCGGCGCCAATGGCCAGATCAGGAACAGA
TGCAACGTCGTCAACTCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGGGTAATAAGCAGCTGGGATGCCTGGTTGCCGTGGCAGTATTGGTCTTGTCCGCCGGAAGCCTGGACACTGCGGCAGCGCAGGCGGCCGGGCTGAAGAAGGGGTTCTACAAGAAG
AGCTGCCCTCAGGCGGAGGACATCGCGCAGAAGGTGGTGTGGAACCGCGTCGCCGGCAACCGCGAGCTCGCCGCCAAGTTCCTCCGCATGTTCTTCCATGACTGCTTCGTCAGG
GGGTGT
GACGCGTCGGTGCTTCTGGACTCGCCGACGAGGACGGCGGAGAAGGACTCGGCGCCGAACCTGTCGCTGGCGGGGTTCGAGGTGATCGACGAGGTGAAGGCGGCGCTGGAGCGGGCGTGC
CCGGGCGTCGTCTCCTGCGCCGACATCGTCGCGCTCGCCGCACGGGACTCCGTGTCTTTCCAGTACGGCAAGAAGCTGTGGGAGGTGGAGACCGGACGCCGCGACGGCTCGATCTCGAGC
GACCAGCAGGCGCTGGACGAGATCCCGGCGCCGTCCTCCACCTTCGACGTCCTCGCCTCCAACTTCTCCAGCAAGGGCCTCGGCGTCCAGGACCTCGTCGTCCTCTCAG
GCGGACATACC
ATCGGAATAGGAAACTGCAACCTCGTCAGCTCCAGGATCTTCAACTTCACCGGCAAAAACAACCCCAGCGACATCGATCCTTCCCTCAACCCACCCTACGCCAAGTTCCTCCAG
GGGCAG
TGCAGGCGTAACCAGGCGGACCCGAACGACAACACGACGGTGGTGCCCATGGACACCGGCAGCAGCACCTCCTTCGACAGCCACTACTTCGTCAACCTTAAAGCCGGGCAGGGGCTCTTC
ACCTCCGACGCCACGCTGGTCACCAACGCCCGCGCAGCCTCCCTCGTCGACAAGCTGCAGGACAATGGCGTCTTCCTCGACCACTTCAAGAACTCCATCAAGCGCATGGGCCAGATCGGG
GTGCTCACCGGCGCCAATGGCCAGATCAGGAACAGATGCAACGTCGTCAACTCCTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGGGTA ATAAGCAGCT GGGATGCCTG GTTGCCGTGG CAGTATTGGT CTTGTCCGCC GGAAGCCTGG ACACTGCGGC AGCGCAGGCG GCCGGGCTGA AGAAGGGGTT CTACAAGAAG  AGCTGCCCTC AGGCGGAGGA CATCGCGCAG AAGGTGGTGT GGAACCGCGT CGCCGGCAAC CGCGAGCTCG CCGCCAAGTT CCTCCGCATG TTCTTCCATG ACTGCTTCGT CAGGGGGTGT  GACGCGTCGG TGCTTCTGGA CTCGCCGACG AGGACGGCGG AGAAGGACTC GGCGCCGAAC CTGTCGCTGG CGGGGTTCGA GGTGATCGAC GAGGTGAAGG CGGCGCTGGA GCGGGCGTGC  CCGGGCGTCG TCTCCTGCGC CGACATCGTC GCGCTCGCCG CACGGGACTC CGTGTCTTTC CAGTACGGCA AGAAGCTGTG GGAGGTGGAG ACCGGACGCC GCGACGGCTC GATCTCGAGC  GACCAGCAGG CGCTGGACGA GATCCCGGCG CCGTCCTCCA CCTTCGACGT CCTCGCCTCC AACTTCTCCA GCAAGGGCCT CGGCGTCCAG GACCTCGTCG TCCTCTCAGG CGGACATACC  ATCGGAATAG GAAACTGCAA CCTCGTCAGC TCCAGGATCT TCAACTTCAC CGGCAAAAAC AACCCCAGCG ACATCGATCC TTCCCTCAAC CCACCCTACG CCAAGTTCCT CCAGGGGCAG  TGCAGGCGTA ACCAGGCGGA CCCGAACGAC AACACGACGG TGGTGCCCAT GGACACCGGC AGCAGCACCT CCTTCGACAG CCACTACTTC GTCAACCTTA AAGCCGGGCA GGGGCTCTTC  ACCTCCGACG CCACGCTGGT CACCAACGCC CGCGCAGCCT CCCTCGTCGA CAAGCTGCAG GACAATGGCG TCTTCCTCGA CCACTTCAAG AACTCCATCA AGCGCATGGG CCAGATCGGG 
GTGCTCACCG GCGCCAATGG CCAGATCAGG AACAGATGCA ACGTCGTCAA CTCCTAA 

Retrieve as FASTA