Entry information : ZmPrx76 (Peroxidase52)
Entry ID 786
Creation 2009-04-14 (Christophe Dunand)
Last sequence changes 2014-01-09 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-15 (Christophe Dunand)
Peroxidase information: ZmPrx76 (Peroxidase52)
Name (synonym) ZmPrx76 (Peroxidase52)
Class Class III peroxidase    [Orthogroup: Prx149]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue types Meristems
Mixed tissues
Roots
Inducer Drought
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx76
start..stop
S start..stop
BdiPrx24 556 0 1..318 1..318
SbPrx137 543 0 1..318 1..318
OsPrx87 522 0 26..318 34..327
OsPrx86 476 6e-171 25..318 31..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..219 219 N° 2 328..519 192 N° 3 622..1170 549  
join(1..219,328..519,622..1170)


exon

Literature and cross-references ZmPrx76 (Peroxidase52)
Literature Bohnert,H. et al., unpublished
Protein ref. UniProtKB:   B6SNF9 [Other strain]
DNA ref. GenBank:   AC188744.3 (129336..130505)
mRNA ref. GenBank:   EU954274.1
Cluster/Prediction ref. UniGene:   Zm.21457
Protein sequence: ZmPrx76 (Peroxidase52)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   318 (294)
PWM (Da):   %s   33301.64 (30807.3)  
PI (pH):   %s   8.64 (8.56) Peptide Signal:   %s   cut: 25 range:25-318
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGTSLARSVALFTLLLCLLLPSHGKLSTKFYAKSCPSVAAIVRSVMEQAVAKEPRMGASIIRLFFHDCFVNGCDASILLDDTSTFTGEKNAGANTNSVRGYEVIDAIKTQVEAACKGTVSCADIVALASRDAVDLLGGPTWNVQLGRKDSRAASQSAANANLPGPGSGAASLVAAFAAKGLSARDMTALSGAHTVGRARCLFFRGRIYTDQNVNASFAAARQQTCPQSGGDGNLAPFDDQTPDAFDNAYYTNLMAQRGLLHSDQELFNGGPQDALVKKYSGNARMFATDFAKAMVKMGGLAPAAGTPTEVRFNCRKVN

Retrieve as FASTA  
Remarks Complete sequence genomic (chromo 2, introns 1 and 2) and 12 ESTs.Containing intron shift.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCACGTCGTTGGCTAGAAGCGTTGCTCTGTTTACTCTGCTGCTCTGCCTGCTTCTTCCGTCCCATGGCCATGGGAAGCTCTCGACCAAGTTCTACGCCAAGTCGTGCCCCAGCGTG
GCCGCCATCGTGCGGTCGGTGATGGAGCAGGCGGTCGCCAAGGAGCCCAGGATGGGCGCCTCCATCATCCGCCTCTTCTTCCACGACTGTTTCGTCAAT
GTCGGTCACATTTAATATCCT
ATATTGCCATCCGGTTAGCCTAGGCTGCCACTCATCAGACGTCAGTGTGCAGTGCGCGGAACCACTGACATGCATGTGCGCGCGCAGGGTTGTGACGCGTCCATCCTCCTGGATGACACT
TCGACGTTCACCGGCGAGAAGAACGCCGGAGCGAACACCAACTCCGTCCGCGGGTACGAGGTGATCGACGCCATCAAGACGCAGGTCGAAGCAGCCTGCAAGGGCACCGTGTCGTGCGCC
GACATCGTCGCCTTGGCGTCTCGTGACGCCGTGGACTTG
GTCAGTTAGTTCGTCTGTTGCTGCTAACACAACAACAACACGACCGTAATAATCCAGTGTCCAGAACCGACGCTGATCCGC
ACGCAATGCAATGCAATGCAGCTCGGAGGCCCCACATGGAACGTGCAGCTCGGCCGGAAGGACTCGCGCGCGGCGAGCCAGAGCGCGGCCAACGCCAACCTCCCGGGCCCGGGCTCCGGC
GCCGCGTCCCTCGTGGCCGCGTTCGCGGCCAAGGGGCTCTCGGCGCGCGACATGACGGCGCTCTCCGGCGCGCACACCGTGGGGCGCGCGCGCTGCCTCTTCTTCCGCGGGCGCATCTAC
ACCGACCAGAACGTCAACGCCTCCTTCGCGGCGGCGCGGCAGCAGACGTGCCCGCAGAGCGGCGGCGACGGCAACCTCGCGCCGTTCGACGACCAGACGCCTGACGCCTTCGACAACGCC
TACTACACGAACCTGATGGCGCAGCGCGGCCTGCTGCACTCGGACCAGGAGCTCTTCAACGGCGGGCCGCAGGATGCGCTGGTCAGGAAGTACAGCGGCAACGCCCGCATGTTCGCCACC
GACTTTGCCAAGGCGATGGTGAAGATGGGCGGTCTTGCGCCGGCGGCCGGAACGCCGACGGAGGTCAGATTCAACTGCCGGAAGGTGAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCACGTCGTTGGCTAGAAGCGTTGCTCTGTTTACTCTGCTGCTCTGCCTGCTTCTTCCGTCCCATGGCCATGGGAAGCTCTCGACCAAGTTCTACGCCAAGTCGTGCCCCAGCGTG
GCCGCCATCGTGCGGTCGGTGATGGAGCAGGCGGTCGCCAAGGAGCCCAGGATGGGCGCCTCCATCATCCGCCTCTTCTTCCACGACTGTTTCGTCAAT
GGTTGTGACGCGTCCATCCTC
CTGGATGACACTTCGACGTTCACCGGCGAGAAGAACGCCGGAGCGAACACCAACTCCGTCCGCGGGTACGAGGTGATCGACGCCATCAAGACGCAGGTCGAAGCAGCCTGCAAGGGCACC
GTGTCGTGCGCCGACATCGTCGCCTTGGCGTCTCGTGACGCCGTGGACTTG
CTCGGAGGCCCCACATGGAACGTGCAGCTCGGCCGGAAGGACTCGCGCGCGGCGAGCCAGAGCGCGGCC
AACGCCAACCTCCCGGGCCCGGGCTCCGGCGCCGCGTCCCTCGTGGCCGCGTTCGCGGCCAAGGGGCTCTCGGCGCGCGACATGACGGCGCTCTCCGGCGCGCACACCGTGGGGCGCGCG
CGCTGCCTCTTCTTCCGCGGGCGCATCTACACCGACCAGAACGTCAACGCCTCCTTCGCGGCGGCGCGGCAGCAGACGTGCCCGCAGAGCGGCGGCGACGGCAACCTCGCGCCGTTCGAC
GACCAGACGCCTGACGCCTTCGACAACGCCTACTACACGAACCTGATGGCGCAGCGCGGCCTGCTGCACTCGGACCAGGAGCTCTTCAACGGCGGGCCGCAGGATGCGCTGGTCAGGAAG
TACAGCGGCAACGCCCGCATGTTCGCCACCGACTTTGCCAAGGCGATGGTGAAGATGGGCGGTCTTGCGCCGGCGGCCGGAACGCCGACGGAGGTCAGATTCAACTGCCGGAAGGTGAAT

Retrieve as FASTA