Entry information : BdiPrx84 (Bradi2g38660)
Entry ID 7867
Creation 2011-01-14 (Toky Ramarohetra)
Last sequence changes 2011-01-14 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx84 (Bradi2g38660)
Name (synonym) BdiPrx84 (Bradi2g38660)
Class Class III peroxidase    [Orthogroup: Prx078]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type Leaves
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx84
start..stop
S start..stop
HvPrx59 597 0 21..342 20..341
TaPrx115 589 0 26..342 24..340
PedPrx02 574 0 22..341 23..342
PedPrx01 573 0 24..341 25..342
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 38941910..38942125 216 N° 2 38944344..38945156 813  
join(38941910..38942125,38944344..38945156)


exon

Literature and cross-references BdiPrx84 (Bradi2g38660)
Literature Vogel,J.P., Gu,Y.Q., Twigg,P., Lazo,G.R., Laudencia-Chingcuanco,D., Hayden,D.M., Donze,T.J., Vivian,L.A., Stamova,B. and Coleman-Derr,D.
EST sequencing and phylogenetic analysis of the model grass Brachypodium distachyon.
Theor Appl Genet 113 (2), 186-195 (2006).
DNA ref. Phytozome 12:   Bd2 (38941910..38945156)
EST ref. GenBank:   DV485440.1 [5' end]   GT805661.1 [3' end]
Protein sequence: BdiPrx84 (Bradi2g38660)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   342 (318)
PWM (Da):   %s   36855.89 (34565.8) Transmb domain:   %s   i7-24o
PI (pH):   %s   6.78 (6.78) Peptide Signal:   %s   cut: 25 range:25-342
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMTKAAAVAVVLVMAAAMAAEAMGGELKVGYYEKSCKGVENVVKYHVAKAIKANRKNGAALVRLIFHDCFVRGCDASVLLDPTPENPSTEKTAPINIGLAAFELIDEIKAAVEERCPGTVSCSDILIYAAHDASSLLSNGHVTFPVLAGRLDGVHSHAAEAQQDLPDSTFTIAQLIHNFARKNFTVEELVILSGAHAVGVGHCSSLRARLTAPPTQILPAYRGLLARKCAAGPDPLVPNNIRDEDKAAVAAAIPGFVPKLRKVNDFLDNSYYHNNLARIVTFNSDWELLTEKEALGHVKEYAENGTLWDEDFSDSLVKLSKLPMPHGSQGEIRKQCRYVNHH*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, intron 1). 2 ESTs. Cultivar="Bd21".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGACGAAGGCGGCCGCGGTGGCCGTGGTGTTGGTGATGGCGGCGGCGATGGCGGCAGAGGCGATGGGGGGTGAGCTGAAGGTTGGGTACTACGAGAAGAGCTGCAAGGGGGTGGAG
AACGTGGTGAAGTACCACGTGGCAAAGGCCATCAAGGCCAACCGCAAGAACGGCGCCGCACTCGTCCGCCTCATCTTCCACGACTGCTTCGTCAGG
GTACGTACGCCGCTCCTCCGTCCG
TCATCGGGTTTTTTTTCCGGAACGGAAGAGATTCCTGGATCGATGCACACAATCGTTTTCATTGGCTAGCTCTGGCAAAACCAAGTCCTTGACATGTTAATGCCGTAGCACTAAGCTAGG
TTTGCACTGGTTTTTACTCATCGTTTAAATCTTCTACTACTCGAATTGAGAGCAACATTTTTGAACTGGTAAATCCATTAAGCACAGGAAGTAGCATCGTACCTCCTCTAGTACGGGGTT
AGCTAGCTAGCTAGCTAACAAGAGAGCAAAATTTTACACGTAACTGTGGACTACAACAAGCACGGGGATAGCTAGCTAACAAAAACAGAGTAAAGAAATTACAAGTCTCTCTCCAGGTCC
AGCAAAGGACTGTCAATCGATCTACACCGTACCACATGCATGCACAGTACTGACACTGGCCCACTGCCACTTAATTAGCGTTTGCATAGCTCGTGATCAAATGTGTTTGCTAGTCTTTTC
CTCTGATGCTGACATGCATAACTCTCTGGCTAATTCTCTCTGCTGTTCGGAAGGCTGCACGACACTAACAAAACTTTAGTTAACCGACTGTTATGAAAAAAATGGTCAATATATTCTAAT
GGCGCCAATGAACAAGTTGGAAGCTAGCACTGGTACTAGTAGATTATTATAGTACCAAAGCTACCAAACCATATCCAACAGATAAGCTAGCACGGTAGTACGTGTGTCACATTAATCTAG
CTAGCACGGAGAATGTGCATGGAAATTAAGAGCAGTAGCTGCACGGGCCTGCCGCGCGTAACTTTCAAAGTTGTTGGGTTTTTTCTTTCTTTCTTTCTTTCATGCGACGAATTTCAAAAT
TGTTGGTTCCCGCGTCATTGTCACGCCCAGATGTTAATCATGGAAGCACGTTACTCCCTCCTGCACTTTCAATGGCTGCTAGCTAAGCTAGCTTAGGCTTAAGCTCAAGCTAGAAATCCA
GAATATGATCCTCGAGAATCGTGCGCTGGTTGCTCACTCACTCCCAGCCAGGCGAGCATGGAGAGCAGAAAGGAATTCGATACTTTCCTTGGACGTGTAGAGAACTGGAGACCAATAATT
TGACATGGCTAATTAGCTAGCTATGCGATATCTTTGGCTCTCTTCGACTCTTCCTCTGCTTTTCTTCCACGCGCATGTCCTTGTCTTTAATTTTTATTCTTTTCACTTCATATTACCGAT
CCCCCATGTGCCTGATGATGATGCGTCTTAAAGCCTTAGGAATCCGCAGTTATGTGTCGTACTCCTGTTAGGGATGCAGAATTAATTCCCCTGGCAAGTGTTTGATTGGATAATCTTTAA
TTCCTCACAAAAAAAAATTGCACTAGATTACAACCTAGCTACGATGCAATGCAACAAATATTGTGATGCATGCGTATGAAGATTGCATGGGTGTAAGTATAATTTAAGCTGACACTCTTA
CCGGTGCCGTTCATTAATTGTTTACATAGAGAGTTGATGAACTTTGCATGCATGCATGCATATGGGTGTAACATAATCCACTCTTTTGAGAGAACCTGCATAATTAAGATTATCTTGTAT
TGTGTATAAATATCCTGGTCTAGACGGACAGGAGCTGGTTAGCTTTTTTTATCATGTTCTTTTGCCACCAAAAGGAAACAAAAGAAAAAACGAGAGAGCTACTGTAAAGAGAAAGAGAAA
GCATACCTATACCAAGATCAATCATTCGTTGCACCAGTAGTGCTCAGTCCATCGCCCACACAAATGGTCAATAGAAAGCCCCCTAATACTATTTGTGTTTAAAGTAATTGATGAGTGAAT
TCCAGGTTGGAAAACATAACTGTTTTGTTTTTATATGGTCACATTATCGGTCCATAAGCATAGACAATTATTGCCCAATAATGCACCACATTGCAGACAATACATATGTACATCTCTTTC
CAACAACTAAAGTTAACCATCACGTTTCAGATCTCCACATGGAGTTAAAATAATTATCATTAGCAAAATGACTTCCCAACCGATCCATGCACACTTACAGTGTACTTACACGTCTCAGTT
AACAGTACTGTACTTAGGGAAATGAAATAAATGCTTTGTCTGCTAACAATATCTTGTTAAGTTAGGTTAAGAATTTATCATTGATGATTGATTAGGCAGCTCAAGCAGAGTGATCATATG
GATAATTAATGTGCTGTACGTGCGTATCGTGCAGGGTTGTGACGCGTCGGTGCTGCTGGACCCGACACCTGAGAACCCATCGACGGAGAAGACAGCGCCGATCAACATCGGCCTCGCCGC
CTTCGAGCTCATCGACGAGATCAAAGCGGCGGTGGAGGAGCGGTGCCCGGGCACGGTCTCCTGCTCGGACATCCTCATCTACGCTGCCCACGACGCGTCGTCCCTCCTGAGCAACGGCCA
CGTCACCTTCCCGGTCCTGGCGGGCCGCCTCGACGGTGTCCACTCCCACGCGGCGGAGGCCCAGCAGGACCTCCCCGACTCCACCTTCACCATCGCCCAGCTCATCCACAACTTCGCGCG
CAAGAACTTCACGGTGGAGGAGCTGGTGATCCTCTCGGGGGCCCACGCGGTGGGCGTGGGCCACTGCTCGTCGCTCCGGGCCCGGCTCACGGCCCCGCCGACCCAGATCCTCCCGGCCTA
CCGGGGCCTCCTGGCCCGGAAGTGCGCGGCGGGGCCGGACCCGCTGGTGCCCAACAACATCCGGGACGAGGACAAGGCGGCGGTGGCGGCGGCGATCCCGGGGTTCGTGCCGAAGCTGAG
GAAAGTGAATGACTTCCTGGACAACAGCTACTACCACAACAACCTTGCCAGGATCGTCACGTTCAACTCCGACTGGGAGCTGCTGACGGAGAAGGAGGCGCTGGGGCACGTCAAGGAGTA
CGCCGAGAACGGCACGCTGTGGGATGAGGACTTCTCTGACTCCCTTGTGAAGCTCAGCAAGCTGCCCATGCCCCATGGCAGCCAGGGAGAGATCAGGAAGCAATGCCGCTACGTCAACCA
CCACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGACGAAGGCGGCCGCGGTGGCCGTGGTGTTGGTGATGGCGGCGGCGATGGCGGCAGAGGCGATGGGGGGTGAGCTGAAGGTTGGGTACTACGAGAAGAGCTGCAAGGGGGTGGAG
AACGTGGTGAAGTACCACGTGGCAAAGGCCATCAAGGCCAACCGCAAGAACGGCGCCGCACTCGTCCGCCTCATCTTCCACGACTGCTTCGTCAGG
GGTTGTGACGCGTCGGTGCTGCTG
GACCCGACACCTGAGAACCCATCGACGGAGAAGACAGCGCCGATCAACATCGGCCTCGCCGCCTTCGAGCTCATCGACGAGATCAAAGCGGCGGTGGAGGAGCGGTGCCCGGGCACGGTC
TCCTGCTCGGACATCCTCATCTACGCTGCCCACGACGCGTCGTCCCTCCTGAGCAACGGCCACGTCACCTTCCCGGTCCTGGCGGGCCGCCTCGACGGTGTCCACTCCCACGCGGCGGAG
GCCCAGCAGGACCTCCCCGACTCCACCTTCACCATCGCCCAGCTCATCCACAACTTCGCGCGCAAGAACTTCACGGTGGAGGAGCTGGTGATCCTCTCGGGGGCCCACGCGGTGGGCGTG
GGCCACTGCTCGTCGCTCCGGGCCCGGCTCACGGCCCCGCCGACCCAGATCCTCCCGGCCTACCGGGGCCTCCTGGCCCGGAAGTGCGCGGCGGGGCCGGACCCGCTGGTGCCCAACAAC
ATCCGGGACGAGGACAAGGCGGCGGTGGCGGCGGCGATCCCGGGGTTCGTGCCGAAGCTGAGGAAAGTGAATGACTTCCTGGACAACAGCTACTACCACAACAACCTTGCCAGGATCGTC
ACGTTCAACTCCGACTGGGAGCTGCTGACGGAGAAGGAGGCGCTGGGGCACGTCAAGGAGTACGCCGAGAACGGCACGCTGTGGGATGAGGACTTCTCTGACTCCCTTGTGAAGCTCAGC
AAGCTGCCCATGCCCCATGGCAGCCAGGGAGAGATCAGGAAGCAATGCCGCTACGTCAACCACCACTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGCATCGATC GCTATATAGC ACACACAACG CTCCCAACGC CTTCCATGAA CTGAGCACCG CACTACGGCC CAACACACGC CACCAACAAC AAACACACAC ACTTGCAACT AGCAGTGTGC  GTGTGCCGGC CACTAGCTAG CTAGTTCAAA ATCGAGCTAG GCAGCTCTTG AGCTAGCTCT CAGCTGCTTC AATTCTGTCG GTGGAGTTAA TTAATTGGCC GGAGAGGATG ATGACGAAGG  CGGCCGCGGT GGCCGTGGTG TTGGTGATGG CGGCGGCGAT GGCGGCAGAG GCGATGGGGG GTGAGCTGAA GGTTGGGTAC TACGAGAAGA GCTGCAAGGG GGTGGAGAAC GTGGTGAAGT  ACCACGTGGC AAAGGCCATC AAGGCCAACC GCAAGAACGG CGCCGCACTC GTCCGCCTCA TCTTCCACGA CTGCTTCGTC AGGGGTTGTG ACGCGTCGGT GCTGCTGGAC CCGACACCTG  AGAACCCATC GACGGAGAAG ACAGCGCCGA TCAACATCGG CCTCGCCGCC TTCGAGCTCA TCGACGAGAT CAAAGCGGCG GTGGAGGAGC GGTGCCCGGG CACGGTCTCC TGCTCGGACA  TCCTCATCTA CGCTGCCCAC GACGCGTCGT CCCTCCTGAG CAACGGCCAC GTCACCTTCC CGGTCCTGGC GGGCCGCCTC GACGGTGTCC ACTCCCACGC GGCGGAGGCC CAGCAGGACC  TCCCCGACTC CACCTTCACC ATCGCCCAGC TCATCCACAA CTTCGCGCGC AAGAACTTCA CGGTGGAGGA GCTGGTGATC CTCTCGGGGG CCCACGCGGT GGGCGTGGGC CACTGCTCGT  CGCTCCGGGC CCGGCTCACG GCCCCGCCGA CCCAGATCCT CCCGGCCTAC CGGGGCCTCC TGGCCCGGAA GTGCGCGGCG GGGCCGGACC CGCTGGTGCC CAACAACATC CGGGACGAGG  ACAAGGCGGC GGTGGCGGCG GCGATCCCGG GGTTCGTGCC GAAGCTGAGG AAAGTGAATG ACTTCCTGGA CAACAGCTAC TACCACAACA ACCTTGCCAG GATCGTCACG TTCAACTCCG  ACTGGGAGCT GCTGACGGAG AAGGAGGCGC TGGGGCACGT CAAGGAGTAC GCCGAGAACG GCACGCTGTG GGATGAGGAC TTCTCTGACT CCCTTGTGAA GCTCAGCAAG CTGCCCATGC  CCCATGGCAG CCAGGGAGAG ATCAGGAAGC AATGCCGCTA CGTCAACCAC CACTAGCTAG CTGCAGCTTC TTCATTTTCG ATCTGCCGCT GAGGTTTAAT TTCCCTGGAT TAGTTAATTA  AATTGCATCG TCGTCGTTCA TGTCGCTCGA ATTTGATCAT TCGTTTGTTG TTATGTTTTA TTCTCCTTTT TTCTCTTGTT TCTTTTTTTG CGTGTGTGTG ATATTGATTT CTTTTCATGT 
ATGGTCTTTT AATCCGCTTG GAGTACCATC CAGATCATGT AATAAGAACA CAAACAAATT AATGAAGTAA ATTTTATATG TTGTTCCTCT TGTGAA 

Retrieve as FASTA