Entry information : BdiPrx105 (Bradi3g20130)
Entry ID 7873
Creation 2011-01-14 (Toky Ramarohetra)
Last sequence changes 2011-01-14 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx105 (Bradi3g20130)
Name (synonym) BdiPrx105 (Bradi3g20130)
Class Class III peroxidase    [Orthogroup: Prx028]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx105
start..stop
S start..stop
TaPrx22-1A 537 0 25..368 22..348
SbPrx103 513 0 18..368 22..369
OsPrx118 512 0 1..368 1..367
SiPrx68 511 0 3..368 8..356
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 19198129..19198440 312 N° 2 19197846..19198037 192 N° 3 19197153..19197755 603  
complement(join(19197153..19197755,19197846..19198037,19198129..19198440))


exon

Literature and cross-references BdiPrx105 (Bradi3g20130)
DNA ref. Phytozome 12:   Bd3 (19198440..19197153)
Protein sequence: BdiPrx105 (Bradi3g20130)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   368 (347)
PWM (Da):   %s   36916.56 (34729.3)  
PI (pH):   %s   4.68 (4.75) Peptide Signal:   %s   cut: 22 range:22-368
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEVALAMALVAFFLLLQLAAAAEATAVNKSCVAGAGGASVSIGYGGARASAGAGAGVSLGGDAYRSVCPLAEEIIREAVEKAVAADPRMAASLLRLHFHDCFVNGCDGSVLLDDKPFLVGEKTAGPNANSLRGFEVIDAIKAQLELACPDTVSCADVLAIAARDSVVASGGPSWQVEVGRKDSRTASLQAANSNLPAPTSGVATLVQKFANVGLSAKDMVALSGAHTIGKARCTTFSARIGGGMGVAGTAKDAGFVQSLQQLCAGSAGSALAHLDLATPATFDNQYYINLLSGDGLLPSDQALAAAPAGDDDGDQDAGTLVAGLVADYAFDAALFFDDFAASMLRMGRLAPAGGRAAGEVRRNCRVVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, 3 introns), no EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGTGGCGTTAGCCATGGCGCTGGTAGCCTTCTTCCTGCTGCTGCAGCTTGCAGCAGCAGCCGAGGCGACCGCGGTGAACAAGTCGTGCGTGGCCGGCGCAGGCGGCGCGTCCGTG
AGCATCGGGTACGGCGGCGCCAGGGCCAGCGCCGGCGCCGGCGCCGGCGTGTCCCTGGGCGGCGACGCGTACCGCTCCGTGTGCCCCCTGGCCGAGGAGATCATCCGCGAGGCCGTCGAG
AAGGCCGTCGCCGCCGACCCCCGCATGGCCGCTTCCCTCCTCCGCCTCCACTTCCACGACTGCTTCGTCAAT
GTACGTGCATGAAGGAACTACAATGCGCTCGGGAATAATGCAGTGCGC
CATTATGACTTCGCGAGTAATTTTGCTCTCTTTTTTGGGTCAGGGTTGCGACGGGTCCGTGCTCCTGGACGACAAGCCGTTCTTGGTGGGCGAGAAGACGGCAGGGCCCAACGCCAACTC
GCTGAGGGGGTTCGAGGTGATCGACGCCATCAAGGCCCAGCTGGAGCTGGCGTGCCCGGACACCGTCTCCTGCGCCGACGTGCTCGCCATCGCCGCCCGGGACTCCGTCGTCGCC
GTAAG
TTTTCCTTAGTCCTTCCTCCACACGCATTAATTCTTCGCATGAACAACAACAATTCGATGTCACATTCTAACTGAAAGCGTGCAGTCTGGCGGGCCGAGCTGGCAGGTGGAGGTGGGCAG
GAAGGACAGCCGCACGGCGAGCCTGCAGGCGGCCAACAGCAACCTCCCGGCGCCGACATCCGGCGTCGCCACGCTCGTGCAGAAGTTCGCCAACGTCGGCCTCTCCGCAAAAGACATGGT
GGCCCTCTCCGGCGCGCACACCATCGGGAAAGCGCGGTGCACGACATTCAGCGCGCGCATCGGTGGCGGGATGGGGGTCGCGGGCACGGCCAAGGACGCGGGGTTCGTGCAGTCGCTGCA
GCAGCTGTGCGCGGGGTCGGCGGGGTCGGCGCTGGCGCACCTGGACCTGGCCACGCCGGCAACGTTCGACAACCAGTACTACATCAACCTGCTCTCCGGGGACGGCCTGCTGCCATCCGA
CCAGGCGCTGGCCGCCGCGCCCGCGGGCGACGATGACGGTGATCAGGATGCCGGCACGCTCGTCGCGGGCCTCGTGGCAGATTACGCCTTCGACGCGGCTCTCTTCTTCGACGACTTCGC
GGCTTCCATGCTGCGGATGGGGAGGCTGGCCCCGGCTGGCGGACGCGCCGCTGGCGAGGTCCGCCGCAACTGCCGTGTCGTCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGTGGCGTTAGCCATGGCGCTGGTAGCCTTCTTCCTGCTGCTGCAGCTTGCAGCAGCAGCCGAGGCGACCGCGGTGAACAAGTCGTGCGTGGCCGGCGCAGGCGGCGCGTCCGTG
AGCATCGGGTACGGCGGCGCCAGGGCCAGCGCCGGCGCCGGCGCCGGCGTGTCCCTGGGCGGCGACGCGTACCGCTCCGTGTGCCCCCTGGCCGAGGAGATCATCCGCGAGGCCGTCGAG
AAGGCCGTCGCCGCCGACCCCCGCATGGCCGCTTCCCTCCTCCGCCTCCACTTCCACGACTGCTTCGTCAAT
GGTTGCGACGGGTCCGTGCTCCTGGACGACAAGCCGTTCTTGGTGGGC
GAGAAGACGGCAGGGCCCAACGCCAACTCGCTGAGGGGGTTCGAGGTGATCGACGCCATCAAGGCCCAGCTGGAGCTGGCGTGCCCGGACACCGTCTCCTGCGCCGACGTGCTCGCCATC
GCCGCCCGGGACTCCGTCGTCGCC
TCTGGCGGGCCGAGCTGGCAGGTGGAGGTGGGCAGGAAGGACAGCCGCACGGCGAGCCTGCAGGCGGCCAACAGCAACCTCCCGGCGCCGACATCC
GGCGTCGCCACGCTCGTGCAGAAGTTCGCCAACGTCGGCCTCTCCGCAAAAGACATGGTGGCCCTCTCCGGCGCGCACACCATCGGGAAAGCGCGGTGCACGACATTCAGCGCGCGCATC
GGTGGCGGGATGGGGGTCGCGGGCACGGCCAAGGACGCGGGGTTCGTGCAGTCGCTGCAGCAGCTGTGCGCGGGGTCGGCGGGGTCGGCGCTGGCGCACCTGGACCTGGCCACGCCGGCA
ACGTTCGACAACCAGTACTACATCAACCTGCTCTCCGGGGACGGCCTGCTGCCATCCGACCAGGCGCTGGCCGCCGCGCCCGCGGGCGACGATGACGGTGATCAGGATGCCGGCACGCTC
GTCGCGGGCCTCGTGGCAGATTACGCCTTCGACGCGGCTCTCTTCTTCGACGACTTCGCGGCTTCCATGCTGCGGATGGGGAGGCTGGCCCCGGCTGGCGGACGCGCCGCTGGCGAGGTC
CGCCGCAACTGCCGTGTCGTCAATTAA

Retrieve as FASTA