Entry information : BdiPrx111 (Bradi3g41340)
Entry ID 7877
Creation 2011-01-14 (Toky Ramarohetra)
Last sequence changes 2011-01-14 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx111 (Bradi3g41340)
Name (synonym) BdiPrx111 (Bradi3g41340)
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx111
start..stop
S start..stop
OsPrx119 469 9e-168 1..335 1..333
SbPrx104 447 3e-159 1..335 1..336
ZmPrx80 447 4e-159 32..335 35..337
SiPrx64 433 1e-153 1..335 1..333
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 43279718..43279957 240 N° 2 43278145..43278336 192 N° 3 43277487..43278062 576  
complement(join(43277487..43278062,43278145..43278336,43279718..43279957))


exon

Literature and cross-references BdiPrx111 (Bradi3g41340)
DNA ref. Phytozome 11:   Bd3 (43279957..43277487)
Protein sequence: BdiPrx111 (Bradi3g41340)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   335 (310)
PWM (Da):   %s   36605.36 (33851.8)  
PI (pH):   %s   7.36 (6.36) Peptide Signal:   %s   cut: 26 range:26-335
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEKRRRISLRAVVAAMALMLSLGEAASYDGGSSGLSPGYYSKTCSNLEKIVLREVTKKKNETVVTIPAVLRLFFHDCLVNGCDASVLIASHNNDAEKNSEDDDSLAGDGYDTVNRVKDAVERECPGVVSCADILALAARDVVNLAYGPYWPVELGRRDGLISKASDVKGKLPDPEMHVKELAAIFDKNGLSMRDMVALSGAHTVGFAHCSRFKKRLYNYNSTMRTDPSFNKYYAQQLKVACPPNVGPTIAVNMDPLSPVTFDNKYYNNLVNGLGLFTSDQVLYTDVASKKTVEEFNASQDQFFKAFVDSMIKLGRVDVKTGSAGEIRRDCTAFNH*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, 2 introns), no EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGAAACGGAGAAGAATCAGCTTGCGCGCCGTAGTCGCGGCGATGGCATTGATGCTGTCGCTCGGCGAGGCGGCGTCTTACGACGGCGGGTCAAGCGGCTTGTCGCCGGGCTACTAC
AGCAAGACGTGCAGCAACCTGGAGAAGATCGTGCTGCGGGAGGTCACCAAGAAGAAGAACGAGACGGTGGTCACCATCCCGGCCGTGCTCCGGCTCTTCTTCCACGACTGCCTCGTCAAC
GTGAGTTCGTCCATCCATTCCCATCCAGATATGCTAACCTTGCATTGCACGCCTGGTTCTTTCTTGCTTGATTTGCTAAATCATGCTCTGAAGTTGTGAAGTAGTCAACCGAAATGTGCA
GCATTTGTTTCCTTCCCTTTTTTCTCTTGAAAAGGAGACTCGATCCACCGGCTCTGGCCTCTGCATCGATTGACGCCCACGGTCGTAGTTGCAGCATTCGATTCATCGGCCGAGTTTTGA
TCCCTTGATCATCAAGCAGTTTCTTGCTATGGTCCCAACTGTTCTTCAGCTTTGCACAGGCTTGGGAATCCTGCTCTTTCCCCCCCTTCTCTTATTCAACAAGCTAGGCATTTCATTATA
GTTTTCCCTGCCCCAAAAGGTATAAAGCTCTCTCCAAGATGCAATCTGCTTTCCAGTCCAGTAGTAGCCTGCAGGCTTCTGCTGTCCCATTAGCAATTCCTCTTCATCAAACGGACCATG
ATTCAGAGCTTGGGATCATACATTAGCGACAAAGAAACGAGATTAGTTAAAGCCAAGGGGGAAATTAGCTTAGCTGCATTGTTTAGTGGGAGGAACAACTCGATCGGCTCGCGTGGTCGT
CGGTTGCGGCAGCCCCATGCATGTGCCAGCGCGACTTTTTATCTCTGCTATCCTCATTATCAAATTGCAGCCATGTCGGATCTCTCCCTTAATCGACTGTCTGTCCAAGCATGACCATAA
TCATTTCAGCCCCTGCTGCTAGTGTTTTGGCCTAGTTGTTGAGATGTACTCTGCATTCTGGGCATCTGCATGAGAAATTGGGAGTTATTTCAGCTGTCTCATCAACTATTACATGTTATA
GGAAAAAGGTAGATTGCTGATCAGCTACAGAATCATTTCAAAGCTATGAAAGGAATAAAGATTGGATGCCTCCCCTGTCGTGCGCATAATGATGTTTAGTGGCGTTCCGGCAATCATGTA
ACTGGCATCACATCTTGGTTTCCCTTTCTTTTGTGTCCCCCTTTTCTGGGTTGACCTGCACACAGGATGAGGGGAGCGTGAACACACGTTGGAAACCAGTTATGCCGGGCCCACTTGCAG
CCTATATACTGGAACGAAAACATAAAGCATTTTCTGTTGAAACTTTTTGTTCCTAAAACAAACAGCTACCAAGGGATCAAACAAAAATTGTTTTCTCATGTGAGTACAGGTTAGTCTACA
AGGTAGGGTAATTCAAAACAGGCTGTGCAAAATCGACGTTTGCAACAACTTTGATGTCTTTAATTTGTTATATAGATGGCCATACATCGTCATGAGTTAATCAAAGTTTAGCGCCACTTC
GTCCATGTTATCATGCCGTTTGCAAACTGTGACTACAATGTTTATTTACCTCCAATTGCAGGGCTGTGACGCTTCAGTCCTAATAGCCTCTCACAACAATGATGCTGAGAAAAACTCAGA
GGACGACGATTCCCTCGCCGGCGACGGCTACGACACAGTCAACCGGGTCAAGGACGCCGTTGAGCGGGAGTGCCCTGGCGTGGTTTCGTGCGCTGACATCCTCGCCCTTGCTGCCAGAGA
CGTCGTAAACCTG
GTAAGCAGCACGGTTCTCCACTACCATTTCCCCTTCACCATTGTCCTTCAGCTCTGAAACCCTGTGTCCAATTTGGTTGCAGGCATACGGACCCTACTGGCCAGTGG
AGCTCGGTCGGCGCGACGGCCTCATCTCTAAGGCCAGCGATGTCAAGGGAAAGTTGCCCGACCCAGAGATGCACGTCAAGGAGCTCGCCGCCATCTTCGACAAGAACGGCCTGTCCATGC
GCGACATGGTTGCGCTCTCCGGCGCGCACACTGTCGGGTTCGCGCACTGCTCTCGCTTCAAAAAACGGCTGTACAATTACAACAGCACCATGCGGACCGACCCGTCATTCAACAAGTACT
ATGCACAGCAGCTCAAGGTGGCGTGTCCGCCCAATGTTGGTCCGACCATCGCTGTCAATATGGACCCCCTCAGCCCCGTCACCTTCGACAACAAGTATTACAACAACCTCGTCAATGGCC
TCGGCCTCTTCACCTCCGACCAGGTGCTCTACACCGACGTTGCGTCGAAGAAGACGGTGGAGGAATTCAACGCGAGCCAGGACCAGTTCTTCAAGGCGTTTGTGGACTCCATGATTAAGC
TGGGAAGAGTAGACGTGAAGACCGGCAGCGCTGGAGAGATCCGAAGAGATTGCACTGCCTTCAACCACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGAAACGGAGAAGAATCAGCTTGCGCGCCGTAGTCGCGGCGATGGCATTGATGCTGTCGCTCGGCGAGGCGGCGTCTTACGACGGCGGGTCAAGCGGCTTGTCGCCGGGCTACTAC
AGCAAGACGTGCAGCAACCTGGAGAAGATCGTGCTGCGGGAGGTCACCAAGAAGAAGAACGAGACGGTGGTCACCATCCCGGCCGTGCTCCGGCTCTTCTTCCACGACTGCCTCGTCAAC
GGCTGTGACGCTTCAGTCCTAATAGCCTCTCACAACAATGATGCTGAGAAAAACTCAGAGGACGACGATTCCCTCGCCGGCGACGGCTACGACACAGTCAACCGGGTCAAGGACGCCGTT
GAGCGGGAGTGCCCTGGCGTGGTTTCGTGCGCTGACATCCTCGCCCTTGCTGCCAGAGACGTCGTAAACCTG
GCATACGGACCCTACTGGCCAGTGGAGCTCGGTCGGCGCGACGGCCTC
ATCTCTAAGGCCAGCGATGTCAAGGGAAAGTTGCCCGACCCAGAGATGCACGTCAAGGAGCTCGCCGCCATCTTCGACAAGAACGGCCTGTCCATGCGCGACATGGTTGCGCTCTCCGGC
GCGCACACTGTCGGGTTCGCGCACTGCTCTCGCTTCAAAAAACGGCTGTACAATTACAACAGCACCATGCGGACCGACCCGTCATTCAACAAGTACTATGCACAGCAGCTCAAGGTGGCG
TGTCCGCCCAATGTTGGTCCGACCATCGCTGTCAATATGGACCCCCTCAGCCCCGTCACCTTCGACAACAAGTATTACAACAACCTCGTCAATGGCCTCGGCCTCTTCACCTCCGACCAG
GTGCTCTACACCGACGTTGCGTCGAAGAAGACGGTGGAGGAATTCAACGCGAGCCAGGACCAGTTCTTCAAGGCGTTTGTGGACTCCATGATTAAGCTGGGAAGAGTAGACGTGAAGACC
GGCAGCGCTGGAGAGATCCGAAGAGATTGCACTGCCTTCAACCACTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGACCACTAT AAAACTGCCC CTCCCCTAGC TCCCATCACC GATAATCTCC CCCATTAATT CCGTCTCCCG GGTCCTCGCG TCCAGTGTCC CCCTCCAGGC CTCCACAGCA ACATCATATC  CCGGCCTCCA TCGATCACCT CACAGCAAGT CGAAGCTAGA CCCAATCATA CTCTCCATGG AGAAACGGAG AAGAATCAGC TTGCGCGCCG TAGTCGCGGC GATGGCATTG ATGCTGTCGC  TCGGCGAGGC GGCGTCTTAC GACGGCGGGT CAAGCGGCTT GTCGCCGGGC TACTACAGCA AGACGTGCAG CAACCTGGAG AAGATCGTGC TGCGGGAGGT CACCAAGAAG AAGAACGAGA  CGGTGGTCAC CATCCCGGCC GTGCTCCGGC TCTTCTTCCA CGACTGCCTC GTCAACGGCT GTGACGCTTC AGTCCTAATA GCCTCTCACA ACAATGATGC TGAGAAAAAC TCAGAGGACG  ACGATTCCCT CGCCGGCGAC GGCTACGACA CAGTCAACCG GGTCAAGGAC GCCGTTGAGC GGGAGTGCCC TGGCGTGGTT TCGTGCGCTG ACATCCTCGC CCTTGCTGCC AGAGACGTCG  TAAACCTGGC ATACGGACCC TACTGGCCAG TGGAGCTCGG TCGGCGCGAC GGCCTCATCT CTAAGGCCAG CGATGTCAAG GGAAAGTTGC CCGACCCAGA GATGCACGTC AAGGAGCTCG  CCGCCATCTT CGACAAGAAC GGCCTGTCCA TGCGCGACAT GGTTGCGCTC TCCGGCGCGC ACACTGTCGG GTTCGCGCAC TGCTCTCGCT TCAAAAAACG GCTGTACAAT TACAACAGCA  CCATGCGGAC CGACCCGTCA TTCAACAAGT ACTATGCACA GCAGCTCAAG GTGGCGTGTC CGCCCAATGT TGGTCCGACC ATCGCTGTCA ATATGGACCC CCTCAGCCCC GTCACCTTCG  ACAACAAGTA TTACAACAAC CTCGTCAATG GCCTCGGCCT CTTCACCTCC GACCAGGTGC TCTACACCGA CGTTGCGTCG AAGAAGACGG TGGAGGAATT CAACGCGAGC CAGGACCAGT  TCTTCAAGGC GTTTGTGGAC TCCATGATTA AGCTGGGAAG AGTAGACGTG AAGACCGGCA GCGCTGGAGA GATCCGAAGA GATTGCACTG CCTTCAACCA CTAGATGGCT GCAGCAGCAA  CTGTAATTCA GATCTATTGT CTGAGTTTGA TATACATGTA CCATTTTTTA GGGGGATTTG ATATACATAT ACTGAGTTTG ATTCTTTTGC GTGAGGTTTA CAACATTTGA GGGTCGTTTT  CTCTTCTTTT TTCTTCTTCC ATTTTTTTAT TTTTTATTTT GCTTACGATT TGTGGGTGCA TTTTTGTACA GCCTGAAGAG TGTAATACCA TTGAGGATTC TCTCTTAAGA AAAAAAAAAG 
TTTAATCT 

Retrieve as FASTA