Entry information : BdiPrx114 (Bradi3g60880)
Entry ID 7880
Creation 2011-01-17 (Toky Ramarohetra)
Last sequence changes 2011-01-17 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx114 (Bradi3g60880)
Name (synonym) BdiPrx114 (Bradi3g60880)
Class Class III peroxidase    [Orthogroup: Prx015]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx114
start..stop
S start..stop
ZmPrx136 420 1e-148 35..331 30..330
OsPrx32 408 6e-144 22..329 16..322
SiPrx75 400 9e-141 38..329 29..322
SbPrx82 395 5e-139 35..331 32..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 59663297..59663542 246 N° 2 59663654..59664403 750  
join(59663297..59663542,59663654..59664403)


exon

Literature and cross-references BdiPrx114 (Bradi3g60880)
DNA ref. Phytozome 12:   Bd3 (59663297..59664403)
Protein sequence: BdiPrx114 (Bradi3g60880)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (295)
PWM (Da):   %s   35106.84 (31197.8) Transmb domain:   %s   i12-34o
PI (pH):   %s   9.15 (9.15) Peptide Signal:   %s   cut: 37 range:37-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPERNQHGSSWAWARPWPSALMLLLVLLALGGVEALSLEHYRQSCPKAEAAVTAAVKQAMSSDHTVPAALLRLHFHDCFVRSCDASVLLDSTSKSKASEKDGAPNASLHALYVIDNAKRAVESLCPAVVSCADIIALAARDAVSLSGGPSWALPLGRKDGRVSLASDAAASLPAPTARFEQLKQAFNARGLSVKDLVALSGAHTLGSAHCSSFQDRIASPALRPSFAKALRRACPANNTDAAAGWAFDSSTPKAKASFDNGYFRMLQSGRGLLTSDEALLTHPKTRAFVALYAASQDEFFRDFVASMLRMSALNDPAGEVRAHCRRRNSS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, intron 1), no EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCCGGAGCGGAACCAGCACGGCAGCAGTTGGGCCTGGGCTAGGCCATGGCCGTCGGCGTTAATGCTGCTGCTGGTACTGCTAGCATTGGGCGGCGTGGAGGCCCTGAGCCTGGAG
CACTACCGGCAGAGCTGCCCCAAGGCAGAGGCTGCGGTGACGGCGGCGGTGAAGCAGGCCATGAGCAGCGACCACACCGTGCCGGCCGCCCTGCTCCGCTTGCATTTCCACGACTGCTTC
GTCAGG
GTACGTGCGTGCTGCATGCATCTCCATTGTTCCTTCCATCCTGGAGTAGCTAGTTGAGGAGTAATTCAATTTGATTCCAGTTTATTGATTGGATTGGGATTTGAGGAGCAGAGC
TGCGACGCCTCCGTCCTCCTCGACTCCACCTCCAAGTCCAAAGCGTCGGAGAAGGACGGCGCTCCCAACGCGTCGCTGCACGCCTTGTACGTCATCGACAACGCCAAGCGCGCCGTCGAG
TCCCTCTGCCCGGCCGTCGTCTCCTGCGCCGACATCATCGCCCTCGCCGCCAGGGACGCCGTCTCCCTCTCCGGCGGGCCGTCCTGGGCCCTCCCGCTGGGCCGCAAGGACGGCCGGGTC
TCCCTCGCCAGCGACGCCGCCGCATCCCTCCCGGCCCCCACGGCGCGCTTCGAGCAGCTCAAGCAGGCGTTCAACGCGCGCGGGCTGTCCGTCAAGGACCTGGTGGCGCTCTCCGGCGCC
CACACGCTCGGCTCCGCGCACTGCTCCTCCTTCCAGGACCGCATCGCCAGCCCGGCCCTGCGCCCGTCCTTCGCCAAGGCGCTCCGCAGGGCGTGCCCGGCCAACAACACGGACGCCGCC
GCCGGATGGGCCTTCGACTCCTCCACGCCCAAGGCCAAGGCCAGCTTCGACAATGGCTACTTCCGGATGCTGCAGAGCGGCCGGGGCCTGCTGACCTCCGACGAGGCGCTGCTCACGCAC
CCCAAGACGCGCGCGTTCGTGGCGCTGTACGCGGCGTCGCAGGACGAGTTCTTCAGGGACTTCGTCGCCTCCATGCTCAGGATGAGCGCGCTCAACGATCCCGCCGGCGAGGTCCGGGCA
CACTGCAGGCGACGCAACAGCTCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCCGGAGCGGAACCAGCACGGCAGCAGTTGGGCCTGGGCTAGGCCATGGCCGTCGGCGTTAATGCTGCTGCTGGTACTGCTAGCATTGGGCGGCGTGGAGGCCCTGAGCCTGGAG
CACTACCGGCAGAGCTGCCCCAAGGCAGAGGCTGCGGTGACGGCGGCGGTGAAGCAGGCCATGAGCAGCGACCACACCGTGCCGGCCGCCCTGCTCCGCTTGCATTTCCACGACTGCTTC
GTCAGG
AGCTGCGACGCCTCCGTCCTCCTCGACTCCACCTCCAAGTCCAAAGCGTCGGAGAAGGACGGCGCTCCCAACGCGTCGCTGCACGCCTTGTACGTCATCGACAACGCCAAGCGC
GCCGTCGAGTCCCTCTGCCCGGCCGTCGTCTCCTGCGCCGACATCATCGCCCTCGCCGCCAGGGACGCCGTCTCCCTCTCCGGCGGGCCGTCCTGGGCCCTCCCGCTGGGCCGCAAGGAC
GGCCGGGTCTCCCTCGCCAGCGACGCCGCCGCATCCCTCCCGGCCCCCACGGCGCGCTTCGAGCAGCTCAAGCAGGCGTTCAACGCGCGCGGGCTGTCCGTCAAGGACCTGGTGGCGCTC
TCCGGCGCCCACACGCTCGGCTCCGCGCACTGCTCCTCCTTCCAGGACCGCATCGCCAGCCCGGCCCTGCGCCCGTCCTTCGCCAAGGCGCTCCGCAGGGCGTGCCCGGCCAACAACACG
GACGCCGCCGCCGGATGGGCCTTCGACTCCTCCACGCCCAAGGCCAAGGCCAGCTTCGACAATGGCTACTTCCGGATGCTGCAGAGCGGCCGGGGCCTGCTGACCTCCGACGAGGCGCTG
CTCACGCACCCCAAGACGCGCGCGTTCGTGGCGCTGTACGCGGCGTCGCAGGACGAGTTCTTCAGGGACTTCGTCGCCTCCATGCTCAGGATGAGCGCGCTCAACGATCCCGCCGGCGAG
GTCCGGGCACACTGCAGGCGACGCAACAGCTCATGA

Retrieve as FASTA