Entry information : BdiPrx115 (Bradi4g05190)
Entry ID 7881
Creation 2011-01-17 (Toky Ramarohetra)
Last sequence changes 2011-01-17 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx115 (Bradi4g05190)
Name (synonym) BdiPrx115 (Bradi4g05190)
Class Class III peroxidase    [Orthogroup: Prx052]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx115
start..stop
S start..stop
BdiPrx116 571 0 1..316 1..319
TaPrx43 473 5e-170 7..318 12..323
SiPrx101 469 1e-168 1..318 1..317
SbPrx120 459 3e-164 29..318 31..320
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4260464..4261064 601 N° 2 4259997..4260352 356  
complement(join(4259997..4260352,4260464..4261064))


exon

Literature and cross-references BdiPrx115 (Bradi4g05190)
DNA ref. Phytozome 12:   Bd4 (4261064..4259997)
Protein sequence: BdiPrx115 (Bradi4g05190)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   318 (292)
PWM (Da):   %s   34347.21 (31710.8) Transmb domain:   %s   i7-29o
PI (pH):   %s   5.9 (5.61) Peptide Signal:   %s   cut: 27 range:27-318
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASFTRCSFLVTVAVLLLALTIGSAHGHGSKGGLSSTFYDKSCPGVQDIVRRVIQDARVADARIPASLIRLHFHDCFVQGCDGSILLDDDLQMMIQSEKGVPANDNSARGFPVVDDIKRALEQACPGVVSCADILAIASEVSVQLAGGPHWRVLLGRRDGTSTNIESANDLPSPFDPLETLQEKFRNFGLDNTDLVALQGAHTFGRVQCQFTLQNCTAGQADEALENLDQATPDVFDNKYYGNLLRGRAQIASDQVMLTDPAAATTTAPIVLWFSHSEKDFFKNFAASMIKMGNIGLLTGKDGEVRNNCRRVNRKHY

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, intron 3), no EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCCTCCTTCACCCGCTGCAGCTTCTTGGTGACAGTAGCAGTGCTGCTACTAGCACTGACAATCGGATCAGCTCACGGCCATGGTTCCAAAGGAGGTCTGAGCTCGACGTTCTAC
GACAAGTCCTGCCCCGGCGTGCAGGACATAGTCCGGCGCGTGATCCAGGACGCCCGCGTCGCCGACGCGCGCATCCCGGCCAGCCTCATCCGGCTCCACTTCCACGACTGCTTCGTCCAG
GGCTGCGACGGCTCGATTCTTCTCGACGATGACCTCCAGATGATGATCCAGAGCGAGAAGGGAGTCCCCGCCAACGACAACTCGGCGCGCGGGTTCCCCGTGGTCGATGACATCAAGCGC
GCTCTGGAGCAGGCCTGCCCCGGCGTCGTCTCCTGCGCCGACATCCTCGCCATTGCGTCCGAGGTCTCCGTCCAATTGGCTGGAGGGCCACACTGGAGAGTGCTTCTTGGCCGCCGTGAC
GGCACGAGCACCAATATTGAGAGTGCCAACGATCTCCCAAGCCCCTTCGACCCCCTTGAGACTCTTCAGGAGAAGTTCAGAAACTTCGGCCTTGACAACACTGACCTCGTCGCCCTCCAA
G
GTAAACATTCTAGGACCTACGTACCAAGTTACACAATCAAATCTCGAAATATTCAGAATGTTTACAGACTGCGACATCTTTAAACTGATTAATCGGTGCTAATTTTTGCAGGAGCGCAC
ACATTTGGGCGGGTGCAGTGTCAGTTCACGCTGCAGAACTGCACGGCGGGGCAGGCTGACGAAGCGTTGGAGAACCTGGACCAGGCTACTCCCGACGTCTTTGACAACAAGTATTACGGC
AATCTCTTGCGCGGCCGCGCGCAGATCGCGTCGGACCAAGTGATGCTGACCGACCCCGCCGCGGCCACGACCACGGCGCCTATTGTTCTCTGGTTCTCCCACAGCGAGAAGGACTTCTTC
AAGAACTTCGCCGCGTCCATGATCAAGATGGGGAACATCGGTCTGCTGACCGGGAAGGATGGCGAGGTCAGGAACAACTGCAGGAGGGTCAACAGGAAACACTACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCCTCCTTCACCCGCTGCAGCTTCTTGGTGACAGTAGCAGTGCTGCTACTAGCACTGACAATCGGATCAGCTCACGGCCATGGTTCCAAAGGAGGTCTGAGCTCGACGTTCTAC
GACAAGTCCTGCCCCGGCGTGCAGGACATAGTCCGGCGCGTGATCCAGGACGCCCGCGTCGCCGACGCGCGCATCCCGGCCAGCCTCATCCGGCTCCACTTCCACGACTGCTTCGTCCAG
GGCTGCGACGGCTCGATTCTTCTCGACGATGACCTCCAGATGATGATCCAGAGCGAGAAGGGAGTCCCCGCCAACGACAACTCGGCGCGCGGGTTCCCCGTGGTCGATGACATCAAGCGC
GCTCTGGAGCAGGCCTGCCCCGGCGTCGTCTCCTGCGCCGACATCCTCGCCATTGCGTCCGAGGTCTCCGTCCAATTGGCTGGAGGGCCACACTGGAGAGTGCTTCTTGGCCGCCGTGAC
GGCACGAGCACCAATATTGAGAGTGCCAACGATCTCCCAAGCCCCTTCGACCCCCTTGAGACTCTTCAGGAGAAGTTCAGAAACTTCGGCCTTGACAACACTGACCTCGTCGCCCTCCAA
G
GAGCGCACACATTTGGGCGGGTGCAGTGTCAGTTCACGCTGCAGAACTGCACGGCGGGGCAGGCTGACGAAGCGTTGGAGAACCTGGACCAGGCTACTCCCGACGTCTTTGACAACAAG
TATTACGGCAATCTCTTGCGCGGCCGCGCGCAGATCGCGTCGGACCAAGTGATGCTGACCGACCCCGCCGCGGCCACGACCACGGCGCCTATTGTTCTCTGGTTCTCCCACAGCGAGAAG
GACTTCTTCAAGAACTTCGCCGCGTCCATGATCAAGATGGGGAACATCGGTCTGCTGACCGGGAAGGATGGCGAGGTCAGGAACAACTGCAGGAGGGTCAACAGGAAACACTACTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CACATCAATC CATCTCTTAG ACATCTCTCT CCAATTCGGC AGAGCAGACA AGATCAGCTT CTTCAATTCT AAACATCCAG TTCCGACACA TGGCCGCCTC CTTCACCCGC TGCAGCTTCT  TGGTGACAGT AGCAGTGCTG CTACTAGCAC TGACAATCGG ATCAGCTCAC GGCCATGGTT CCAAAGGAGG TCTGAGCTCG ACGTTCTACG ACAAGTCCTG CCCCGGCGTG CAGGACATAG  TCCGGCGCGT GATCCAGGAC GCCCGCGTCG CCGACGCGCG CATCCCGGCC AGCCTCATCC GGCTCCACTT CCACGACTGC TTCGTCCAGG GCTGCGACGG CTCGATTCTT CTCGACGATG  ACCTCCAGAT GATGATCCAG AGCGAGAAGG GAGTCCCCGC CAACGACAAC TCGGCGCGCG GGTTCCCCGT GGTCGATGAC ATCAAGCGCG CTCTGGAGCA GGCCTGCCCC GGCGTCGTCT  CCTGCGCCGA CATCCTCGCC ATTGCGTCCG AGGTCTCCGT CCAATTGGCT GGAGGGCCAC ACTGGAGAGT GCTTCTTGGC CGCCGTGACG GCACGAGCAC CAATATTGAG AGTGCCAACG  ATCTCCCAAG CCCCTTCGAC CCCCTTGAGA CTCTTCAGGA GAAGTTCAGA AACTTCGGCC TTGACAACAC TGACCTCGTC GCCCTCCAAG GAGCGCACAC ATTTGGGCGG GTGCAGTGTC  AGTTCACGCT GCAGAACTGC ACGGCGGGGC AGGCTGACGA AGCGTTGGAG AACCTGGACC AGGCTACTCC CGACGTCTTT GACAACAAGT ATTACGGCAA TCTCTTGCGC GGCCGCGCGC  AGATCGCGTC GGACCAAGTG ATGCTGACCG ACCCCGCCGC GGCCACGACC ACGGCGCCTA TTGTTCTCTG GTTCTCCCAC AGCGAGAAGG ACTTCTTCAA GAACTTCGCC GCGTCCATGA  TCAAGATGGG GAACATCGGT CTGCTGACCG GGAAGGATGG CGAGGTCAGG AACAACTGCA GGAGGGTCAA CAGGAAACAC TACTGAAGAG AACGAGATTG ATGGTGTTTC ATGAAGATAA  AATTTGATTT TTGTTCTTTT TCTTGTCTTC TACCAATTGT GGTGCTTGCT AAGATCATTC TTTCATTTCA TTCTAACTGT AAAGTGTTCT TCTTTTCTTG TCTTCAAAAA CAAATGTAAA 
TGTTCTTCCT CCACTACATG TATTTACACT TCAAGAGATT ATATGGTCAT ATGGCTACTT TCGTG 

Retrieve as FASTA