Entry information : BdiPrx116 (Bradi4g05230)
Entry ID 7882
Creation 2011-01-17 (Toky Ramarohetra)
Last sequence changes 2011-01-17 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx116 (Bradi4g05230)
Name (synonym) BdiPrx116 (Bradi4g05230)
Class Class III peroxidase    [Orthogroup: Prx053]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx116
start..stop
S start..stop
BdiPrx115 572 0 1..319 1..316
TaPrx43 494 2e-178 1..319 1..321
SiPrx101 483 1e-173 7..319 1..315
SbPrx124 476 4e-171 1..319 1..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4295039..4295648 610 N° 2 4295766..4296115 350  
join(4295039..4295648,4295766..4296115)


exon

Literature and cross-references BdiPrx116 (Bradi4g05230)
DNA ref. Phytozome 12:   Bd4 (4295039..4296115)
Protein sequence: BdiPrx116 (Bradi4g05230)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319 (288)
PWM (Da):   %s   34370.15 (31268.5) Transmb domain:   %s   i7-29o
PI (pH):   %s   5.36 (4.97) Peptide Signal:   %s   cut: 32 range:32-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASSFLARCSFLVTLAVLLVLALTTGSAHGHGSKGGLSSTFYDESCPGAQDIVRRVIQDARVSDARIPASLIRLHFHDCFVQGCDGSILLDDDLQRMIQSEKAVPANDNSARGFPVVDDIKRALEQACPGVVSCADILAIASEVSVQLAGGPYWRVLLGRRDGTSTNIQGANDLPSPFDSLETLQEKFRNFGLDNTDLVALQGAHTFGRVQCQFTQQNCTAGQADEALENLDQATPDVFDNKYYGNLLRGRAQLASDQVMLSDPVAATTTAPVVQRFSNSQKDFFKNFAASMIKMGNISPLTGKDGEIRNNCRRVNRK

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, intron 3), no EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCCTCCTCTTTCCTTGCTCGCTGCAGCTTCTTGGTGACACTAGCAGTGCTGCTAGTACTAGCACTGACAACCGGATCAGCTCACGGCCATGGCTCCAAAGGAGGTCTGAGCTCG
ACGTTCTACGACGAGTCCTGCCCCGGCGCGCAGGACATAGTCCGGCGCGTGATCCAGGACGCCCGCGTGTCCGACGCGCGCATCCCGGCCAGCCTCATCCGGCTCCACTTCCACGACTGC
TTCGTCCAGGGCTGCGACGGCTCGATCCTTCTCGACGACGACCTCCAGAGGATGATCCAGAGCGAGAAGGCAGTCCCCGCCAACGACAACTCGGCGCGTGGGTTCCCCGTCGTCGACGAC
ATCAAGCGCGCGCTGGAGCAGGCCTGCCCCGGCGTCGTCTCCTGCGCCGACATCCTCGCCATTGCGTCCGAGGTCTCTGTCCAATTGGCTGGAGGCCCGTACTGGAGGGTGCTTCTCGGC
CGCCGTGACGGCACGAGCACCAATATTCAGGGTGCCAACGATCTCCCAAGCCCCTTCGACTCCCTCGAGACTCTTCAGGAGAAGTTCAGGAACTTCGGCCTTGACAACACTGACCTCGTC
GCCCTCCAAG
GTAGTAACATTCTAGGACCTGCGTGCCAAGTTACACGACCAAATCTCGAAATATTCAGAATGTTTTACAGACTGCGACATCTTTAATAGACTGATTAATCGGTGCTAATT
CTTGCAGGAGCGCACACATTTGGGCGGGTGCAGTGTCAGTTCACGCAGCAGAACTGCACGGCCGGGCAGGCTGACGAAGCGTTGGAGAACCTGGACCAGGCTACTCCCGACGTTTTCGAC
AACAAGTACTACGGCAATCTCTTGCGCGGCCGGGCACAGCTCGCCTCGGACCAAGTGATGCTGTCCGACCCCGTCGCGGCCACAACCACCGCGCCTGTTGTTCAACGGTTCTCCAACAGC
CAGAAGGACTTCTTCAAGAACTTCGCCGCGTCCATGATCAAGATGGGGAACATAAGCCCGCTGACCGGAAAAGATGGAGAGATCAGGAACAACTGCAGGAGGGTCAACAGAAAATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCCTCCTCTTTCCTTGCTCGCTGCAGCTTCTTGGTGACACTAGCAGTGCTGCTAGTACTAGCACTGACAACCGGATCAGCTCACGGCCATGGCTCCAAAGGAGGTCTGAGCTCG
ACGTTCTACGACGAGTCCTGCCCCGGCGCGCAGGACATAGTCCGGCGCGTGATCCAGGACGCCCGCGTGTCCGACGCGCGCATCCCGGCCAGCCTCATCCGGCTCCACTTCCACGACTGC
TTCGTCCAGGGCTGCGACGGCTCGATCCTTCTCGACGACGACCTCCAGAGGATGATCCAGAGCGAGAAGGCAGTCCCCGCCAACGACAACTCGGCGCGTGGGTTCCCCGTCGTCGACGAC
ATCAAGCGCGCGCTGGAGCAGGCCTGCCCCGGCGTCGTCTCCTGCGCCGACATCCTCGCCATTGCGTCCGAGGTCTCTGTCCAATTGGCTGGAGGCCCGTACTGGAGGGTGCTTCTCGGC
CGCCGTGACGGCACGAGCACCAATATTCAGGGTGCCAACGATCTCCCAAGCCCCTTCGACTCCCTCGAGACTCTTCAGGAGAAGTTCAGGAACTTCGGCCTTGACAACACTGACCTCGTC
GCCCTCCAAG
GAGCGCACACATTTGGGCGGGTGCAGTGTCAGTTCACGCAGCAGAACTGCACGGCCGGGCAGGCTGACGAAGCGTTGGAGAACCTGGACCAGGCTACTCCCGACGTTTTC
GACAACAAGTACTACGGCAATCTCTTGCGCGGCCGGGCACAGCTCGCCTCGGACCAAGTGATGCTGTCCGACCCCGTCGCGGCCACAACCACCGCGCCTGTTGTTCAACGGTTCTCCAAC
AGCCAGAAGGACTTCTTCAAGAACTTCGCCGCGTCCATGATCAAGATGGGGAACATAAGCCCGCTGACCGGAAAAGATGGAGAGATCAGGAACAACTGCAGGAGGGTCAACAGAAAATGA

Retrieve as FASTA