Entry information : ZmPrx79
Entry ID 789
Creation 2007-11-12 (Christophe Dunand)
Last sequence changes 2010-12-23 (Marie Brette (Scipio))
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-12-28 (Christophe Dunand)
Peroxidase information: ZmPrx79
Name ZmPrx79
Class Class III peroxidase    [Orthogroup: Prx090]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue types Seedlings
Silks
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx79
start..stop
S start..stop
SbPrx43 540 0 63..362 66..364
SbPrx42 536 0 62..362 61..360
SiPrx143 503 0 64..362 49..347
SiPrx119 490 2e-175 4..362 8..355
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 212853374..212853700 327 N° 2 212852517..212853278 762  
complement(join(212852517..212853278,212853374..212853700))


exon

Literature and cross-references ZmPrx79
Literature Qiu,F. et al., unpublished
DNA ref. GenBank:   AC193386.2 (99156..100337)
EST ref. GenBank:   BM078834 [3' end]
Cluster/Prediction ref. UniGene:   Zm.32932
Protein sequence: ZmPrx79
Sequence Properties
first value : protein
second value (mature protein)
Length (aa): %sProtein length in amino acid 362 (343)
PWM (Da): %sMolecular Weight of protein
Protein Mw is calculated by the addition of average isotopic masses
of amino acids in the protein and the average isotopic mass of one water molecule.
Molecular weight values are given in Dalton (Da).
38714.83 (36835.7)  
PI (pH): %sIso electric point of protein
Calculation done with EMBOSS parameters.
Please see Dataset for pKi calculation for more information
9.07 (9.07) Peptide Signal: %sProtein signal for mature protein.
if exist :cut position of signal peptide.
range: start-end pos of mature protein
cut: 25 range:20-362
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARLGVLVLVALLAADTTAQLAQAQGSSSSYGSAPPPPPPTSPPSASPPAQTPPPAPTPPTPKLRYNFYKRSCPYAEDIIKQAVRNATNVNPGLGAGLIRMAFHDCFVRGCDGSVLLDATPANPRPEKLGPPNFPSLRGYEVVDAAKAALEKACPGVVSCADVVQFAARDAVFFLSGSKVLYSLPGGRFDGRVSFENETLRFLPPPSFNLSQLVQSFKVKGMSVDDLVVLSGSHTIGRSHCSSFSDRISTPPSDMNPALATVLKRQCPANPNFTNDPTVVQDIVTPDKLDNQYYWNVLRHNVLFKSDAALLTSTETARMVLENAGIRGRFERKFASAMLKMSLIEVKTAATGEIRKNCHVVN*

Retrieve as FASTA  
Remarks Complete sequence from 2 ESTs and genomic (chromo 2, intron 1). Cultivar="B73". FHDC is lacking in the DNA.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAGGCTTGGCGTCCTCGTCTTGGTTGCGCTTCTCGCCGCTGACACCACAGCTCAACTTGCTCAAGCGCAAGGGTCCTCCTCCTCCTACGGCAGTGCTCCTCCTCCTCCTCCTCCA
ACTAGCCCGCCGAGCGCAAGCCCACCAGCCCAGACTCCACCACCGGCTCCTACTCCGCCAACGCCAAAGCTGAGGTACAACTTCTACAAGCGCTCGTGCCCTTACGCCGAGGACATCATC
AAGCAAGCCGTGAGGAACGCCACGAACGTCAACCCCGGCCTCGGCGCCGGCCTCATCCGCATGGCCTTCCACGACTGCTTCGTCCGG
GTACGTGAACCCCAATGCTAGCTGCCAAAATTT
GTCCGTGCATGCATGCAATGCACGCGTGAGTGACCACACCACGTGTTTGTTGTTGTTTGCAGGGCTGCGACGGCTCCGTCCTGCTCGACGCGACGCCGGCGAACCCGCGGCCGGAGAAGC
TCGGCCCGCCAAACTTTCCTAGCCTGCGCGGCTACGAGGTGGTGGACGCGGCCAAGGCGGCGCTCGAGAAGGCCTGCCCGGGCGTCGTCTCCTGCGCCGACGTCGTCCAGTTCGCCGCTC
GCGACGCCGTCTTCTTCCTCAGCGGCTCCAAGGTGCTCTACAGCCTCCCCGGGGGCCGCTTCGACGGCAGGGTGTCCTTCGAGAACGAGACGCTCAGGTTCCTGCCGCCGCCGTCCTTCA
ACCTCTCCCAGCTCGTCCAGAGCTTCAAGGTCAAGGGCATGAGCGTCGACGACCTCGTCGTGCTCTCCGGCTCCCACACCATCGGCCGCTCCCACTGCTCCTCCTTCTCCGACCGCATCT
CCACGCCGCCCTCCGACATGAACCCTGCCCTCGCCACCGTGCTGAAGCGGCAGTGCCCGGCCAACCCCAACTTCACCAACGACCCCACGGTGGTGCAGGACATCGTCACCCCCGACAAGC
TGGACAACCAGTACTACTGGAACGTGCTACGTCACAATGTGCTGTTCAAATCCGACGCGGCCCTGCTGACGTCGACGGAGACGGCGAGGATGGTGCTCGAGAACGCCGGCATCCGAGGAA
GGTTTGAGAGGAAGTTCGCCAGCGCGATGCTCAAGATGTCGCTCATCGAGGTCAAGACCGCTGCCACCGGCGAGATCAGGAAGAACTGCCACGTCGTCAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAGGCTTGGCGTCCTCGTCTTGGTTGCGCTTCTCGCCGCTGACACCACAGCTCAACTTGCTCAAGCGCAAGGGTCCTCCTCCTCCTACGGCAGTGCTCCTCCTCCTCCTCCTCCA
ACTAGCCCGCCGAGCGCAAGCCCACCAGCCCAGACTCCACCACCGGCTCCTACTCCGCCAACGCCAAAGCTGAGGTACAACTTCTACAAGCGCTCGTGCCCTTACGCCGAGGACATCATC
AAGCAAGCCGTGAGGAACGCCACGAACGTCAACCCCGGCCTCGGCGCCGGCCTCATCCGCATGGCCTTCCACGACTGCTTCGTCCGG
GGCTGCGACGGCTCCGTCCTGCTCGACGCGACG
CCGGCGAACCCGCGGCCGGAGAAGCTCGGCCCGCCAAACTTTCCTAGCCTGCGCGGCTACGAGGTGGTGGACGCGGCCAAGGCGGCGCTCGAGAAGGCCTGCCCGGGCGTCGTCTCCTGC
GCCGACGTCGTCCAGTTCGCCGCTCGCGACGCCGTCTTCTTCCTCAGCGGCTCCAAGGTGCTCTACAGCCTCCCCGGGGGCCGCTTCGACGGCAGGGTGTCCTTCGAGAACGAGACGCTC
AGGTTCCTGCCGCCGCCGTCCTTCAACCTCTCCCAGCTCGTCCAGAGCTTCAAGGTCAAGGGCATGAGCGTCGACGACCTCGTCGTGCTCTCCGGCTCCCACACCATCGGCCGCTCCCAC
TGCTCCTCCTTCTCCGACCGCATCTCCACGCCGCCCTCCGACATGAACCCTGCCCTCGCCACCGTGCTGAAGCGGCAGTGCCCGGCCAACCCCAACTTCACCAACGACCCCACGGTGGTG
CAGGACATCGTCACCCCCGACAAGCTGGACAACCAGTACTACTGGAACGTGCTACGTCACAATGTGCTGTTCAAATCCGACGCGGCCCTGCTGACGTCGACGGAGACGGCGAGGATGGTG
CTCGAGAACGCCGGCATCCGAGGAAGGTTTGAGAGGAAGTTCGCCAGCGCGATGCTCAAGATGTCGCTCATCGAGGTCAAGACCGCTGCCACCGGCGAGATCAGGAAGAACTGCCACGTC
GTCAATTAG

Retrieve as FASTA