Entry information : BdiPrx124 (Bradi4g40680)
Entry ID 7890
Creation 2011-01-17 (Toky Ramarohetra)
Last sequence changes 2011-01-17 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx124 (Bradi4g40680)
Name (synonym) BdiPrx124 (Bradi4g40680)
Class Class III peroxidase    [Orthogroup: Prx016]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx124
start..stop
S start..stop
OsPrx137 468 5e-168 1..312 7..327
SiPrx53 448 6e-160 15..312 21..331
SbPrx106 442 9e-158 22..312 37..341
ZmPrx130 435 6e-155 1..312 16..334
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 45010749..45010952 204 N° 2 45011052..45011786 735  
join(45010749..45010952,45011052..45011786)


exon

Literature and cross-references BdiPrx124 (Bradi4g40680)
DNA ref. Phytozome 12:   Bd4 (45010749..45011786)
Protein sequence: BdiPrx124 (Bradi4g40680)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   312 (291)
PWM (Da):   %s   32277.42 (30126.2)  
PI (pH):   %s   4.52 (4.57) Peptide Signal:   %s   cut: 22 range:22-312
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALLLLLVLLELAAMTGLSQGQLQVGFYSESCPDAEDIVSSAVQDAAASDPTLLPALVRLQFHDCFVRGCDGSVLIAGAEVKNSKHQGLRGLDVVDAAKALLEEQCPGVVSCADVLALAARDAIGMTNGPSFDVPTGRRDGLASNVRDADVLPDASDNIQTLRSKFATAGLDDRDLVLLTAAHTIGTTACFFVKDRLYGASGSDPGIPAGYLAELKARCAPGDFNTRVPLDRGSEARFDGSILRNIQAGLVPIASDAALVADNATAALVGAYIGSPRFRRDFVGAMVKMGTIGVITGGNGEIRDVCSAFNTN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, intron 1), no EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCTGTTGCTGCTACTGGTGCTGCTGGAACTAGCAGCGATGACGGGCCTGTCTCAGGGGCAGCTCCAGGTGGGGTTCTACTCGGAGTCCTGCCCGGACGCCGAAGACATCGTGTCC
TCGGCGGTCCAGGACGCCGCCGCATCCGACCCCACTCTCCTCCCCGCCCTCGTCCGCCTCCAGTTCCACGACTGCTTCGTCAGA
GTACGTGAGCTAATAATCCCCTCCTTATATACTAGT
TAAACTTGGCCGTGTCGAATGTCATATGCTGATGTCCATGGCGGCATGGCAATGGCGCTGCAGGGGTGCGACGGGTCGGTGCTGATCGCGGGCGCTGAAGTCAAGAACAGCAAGCACCAG
GGCCTCCGGGGCCTGGACGTGGTGGACGCGGCCAAGGCGTTGCTGGAGGAGCAGTGCCCAGGGGTCGTCTCCTGCGCCGACGTCCTCGCCCTGGCCGCCCGCGACGCCATCGGCATGACC
AACGGGCCTTCCTTCGACGTGCCGACGGGGCGCCGGGACGGGCTGGCCTCCAACGTCCGCGACGCGGACGTGCTCCCGGACGCCAGCGACAACATCCAGACCCTCCGGTCCAAGTTCGCC
ACGGCCGGGCTCGACGACCGGGACCTGGTGCTGCTCACCGCGGCGCACACCATCGGCACCACGGCGTGCTTCTTCGTCAAGGACCGGCTCTACGGCGCGTCGGGCTCCGACCCGGGGATC
CCGGCGGGGTACCTGGCGGAGCTCAAGGCACGGTGCGCGCCGGGGGACTTCAACACGCGGGTGCCGCTCGACAGGGGCAGCGAGGCCCGGTTCGATGGGTCGATCCTGAGGAACATTCAG
GCCGGGCTCGTCCCCATTGCTTCTGACGCCGCTCTTGTCGCCGATAATGCCACCGCCGCGCTTGTTGGCGCGTACATCGGTTCCCCGAGGTTTAGGAGGGATTTTGTGGGAGCTATGGTG
AAGATGGGTACTATTGGGGTGATTACTGGGGGTAATGGGGAGATCAGGGACGTCTGCTCAGCGTTCAACACCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCTGTTGCTGCTACTGGTGCTGCTGGAACTAGCAGCGATGACGGGCCTGTCTCAGGGGCAGCTCCAGGTGGGGTTCTACTCGGAGTCCTGCCCGGACGCCGAAGACATCGTGTCC
TCGGCGGTCCAGGACGCCGCCGCATCCGACCCCACTCTCCTCCCCGCCCTCGTCCGCCTCCAGTTCCACGACTGCTTCGTCAGA
GGGTGCGACGGGTCGGTGCTGATCGCGGGCGCTGAA
GTCAAGAACAGCAAGCACCAGGGCCTCCGGGGCCTGGACGTGGTGGACGCGGCCAAGGCGTTGCTGGAGGAGCAGTGCCCAGGGGTCGTCTCCTGCGCCGACGTCCTCGCCCTGGCCGCC
CGCGACGCCATCGGCATGACCAACGGGCCTTCCTTCGACGTGCCGACGGGGCGCCGGGACGGGCTGGCCTCCAACGTCCGCGACGCGGACGTGCTCCCGGACGCCAGCGACAACATCCAG
ACCCTCCGGTCCAAGTTCGCCACGGCCGGGCTCGACGACCGGGACCTGGTGCTGCTCACCGCGGCGCACACCATCGGCACCACGGCGTGCTTCTTCGTCAAGGACCGGCTCTACGGCGCG
TCGGGCTCCGACCCGGGGATCCCGGCGGGGTACCTGGCGGAGCTCAAGGCACGGTGCGCGCCGGGGGACTTCAACACGCGGGTGCCGCTCGACAGGGGCAGCGAGGCCCGGTTCGATGGG
TCGATCCTGAGGAACATTCAGGCCGGGCTCGTCCCCATTGCTTCTGACGCCGCTCTTGTCGCCGATAATGCCACCGCCGCGCTTGTTGGCGCGTACATCGGTTCCCCGAGGTTTAGGAGG
GATTTTGTGGGAGCTATGGTGAAGATGGGTACTATTGGGGTGATTACTGGGGGTAATGGGGAGATCAGGGACGTCTGCTCAGCGTTCAACACCAACTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCTGT TGCTGCTACT GGTGCTGCTG GAACTAGCAG CGATGACGGG CCTGTCTCAG GGGCAGCTCC AGGTGGGGTT CTACTCGGAG TCCTGCCCGG ACGCCGAAGA CATCGTGTCC  TCGGCGGTCC AGGACGCCGC CGCATCCGAC CCCACTCTCC TCCCCGCCCT CGTCCGCCTC CAGTTCCACG ACTGCTTCGT CAGAGGGTGC GACGGGTCGG TGCTGATCGC GGGCGCTGAA  GTCAAGAACA GCAAGCACCA GGGCCTCCGG GGCCTGGACG TGGTGGACGC GGCCAAGGCG TTGCTGGAGG AGCAGTGCCC AGGGGTCGTC TCCTGCGCCG ACGTCCTCGC CCTGGCCGCC  CGCGACGCCA TCGGCATGAC CAACGGGCCT TCCTTCGACG TGCCGACGGG GCGCCGGGAC GGGCTGGCCT CCAACGTCCG CGACGCGGAC GTGCTCCCGG ACGCCAGCGA CAACATCCAG  ACCCTCCGGT CCAAGTTCGC CACGGCCGGG CTCGACGACC GGGACCTGGT GCTGCTCACC GCGGCGCACA CCATCGGCAC CACGGCGTGC TTCTTCGTCA AGGACCGGCT CTACGGCGCG  TCGGGCTCCG ACCCGGGGAT CCCGGCGGGG TACCTGGCGG AGCTCAAGGC ACGGTGCGCG CCGGGGGACT TCAACACGCG GGTGCCGCTC GACAGGGGCA GCGAGGCCCG GTTCGATGGG  TCGATCCTGA GGAACATTCA GGCCGGGCTC GTCCCCATTG CTTCTGACGC CGCTCTTGTC GCCGATAATG CCACCGCCGC GCTTGTTGGC GCGTACATCG GTTCCCCGAG GTTTAGGAGG  GATTTTGTGG GAGCTATGGT GAAGATGGGT ACTATTGGGG TGATTACTGG GGGTAATGGG GAGATCAGGG ACGTCTGCTC AGCGTTCAAC ACCAACTGAG AATTAATGTG AGATTGTGAG  GTCGATGTGA TAGAGAGAGA GAGATCGAAC GTATACGTTG CTTGTTATAC ACGTGCTGAA TGACATTGTT AGATGCATGC GGAAAATCGC TGTACATTTC TTGGGAAAAC GTGGACATAT 
ATTTTTCT 

Retrieve as FASTA