Entry information : BdiPrx125 (Bradi4g44510)
Entry ID 7892
Creation 2011-01-17 (Toky Ramarohetra)
Last sequence changes 2014-01-08 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2014-03-28 (Christophe Dunand)
Peroxidase information: BdiPrx125 (Bradi4g44510)
Name (synonym) BdiPrx125 (Bradi4g44510)
Class Class III peroxidase     [Orthogroup: Prx008]*
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx125
start..stop
S start..stop
BdiPrx126 466 9e-167 13..324 17..329
TaPrx27 464 4e-166 10..324 16..330
HvPrx26 461 3e-165 5..324 1..320
SbPrx84 443 8e-158 30..324 33..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 47885121..47885534 414 N° 2 47884398..47884568 171 N° 3 47878523..47878954 432  
complement(join(47878523..47878954,47884398..47884568,47885121..47885534))


exon

Literature and cross-references BdiPrx125 (Bradi4g44510)
DNA ref. Phytozome 12:   Bd4 (47885534..47878583)
Protein sequence: BdiPrx125 (Bradi4g44510)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (297)
PWM (Da):   %s   33844.76 (31172.4) Transmb domain:   %s   i7-26o
PI (pH):   %s   5.65 (5.65) Peptide Signal:   %s   cut: 28 range:28-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASGMNIINANALCVLVLVAMAAGSWAQQQLSTGFYSASCPGAQAAVRSAVESAIGKETRIGASILQLFFHDCFVQGCDGSLLLDDTAGFQGEKTAAPNNGSVRGFEVVDDAKAAVERICPGVVSCADVLALAARDSVVLAGPSWEVKLGRRDSTTASFAGANANMPAATSGLRELTDLFANQGLSQKDMVALSGKLHVGTGSHTLGQARCVNFDIDSGFAGTHRSSCSSNSVSGDGNSLAPLDLQTPLVFENNYYKNLVDRKGLLHSDQELFNGGVTDQQVRSYVDNQSVFFADFLAGMIKLGDISPLTGTNGQIRKNCRRIN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, 2 introns).Nno EST. Incorrect prediction from phytozome (sequence between SCADIL and GGP is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCGGGCATGAATATTATCAATGCTAATGCCCTGTGCGTCCTGGTCTTGGTCGCCATGGCCGCCGGCTCGTGGGCGCAGCAGCAGCTGTCGACGGGGTTCTACTCGGCGTCGTGC
CCGGGCGCGCAGGCCGCCGTGAGGTCCGCCGTGGAGTCCGCCATTGGCAAGGAGACCCGCATCGGCGCCTCCATCCTCCAGCTCTTCTTCCACGACTGCTTCGTCCAGGGCTGCGACGGG
TCGCTGCTGCTGGACGACACGGCGGGGTTCCAGGGGGAGAAGACGGCGGCGCCCAACAATGGCTCCGTGCGTGGCTTCGAGGTGGTGGACGACGCCAAGGCCGCCGTCGAGAGGATCTGC
CCCGGCGTCGTCTCGTGCGCCGACGTGCTCGCCCTCGCCGCCAGGGACAGCGTC
GTCCTCGTAAGCTCTAGCTAGCTAGCCCCTGTTTTAACCTTTACTACTTTCCGTTGCATATATGCA
TGCATGATGAAATGCATGTAGTATTAGCGATTTCTCTTATCAATCCCTTGCCTTCTTCTTGTACATAAACTTTTTGACTTCTTTATAAGAAAATGTGGTGCCGGCTAGCTTTTGCCCGAC
GTAATAACTTTTACTACTTTCCGTTCGATATATATATGCATGCATGATGAAATGCATGTATATATTAACGATTTTAAATCCCTTGCCTTCTTCTTGTACATAAACTTTTGGTTTCTTTAT
TAGAAAAATGTGGTACACGCTGGCTGGCTCCCGCCGTAGTTTCCTTCCAAAAAAAAATGTATTAACGATGATTAAGGGTGCAAATTAAAAGGTTAGCGTTAGGGTATCCCTCCAATCCTT
CTTAGTTTTAAAATAGACTAGTTTTCGAAAAATGATGTGGTTTTAAAATTTTGGTTCTAAGTAGGGTGGAAGGATAGCCTTAATTAGGGTACCCGTTTGCACCTCTTACGCGGCCATGTG
TGTTGTAGCTGCGGGTCCGAGCTGGGAGGTGAAGCTGGGGCGGCGGGACTCAACGACGGCGAGCTTCGCCGGCGCCAACGCCAACATGCCGGCGGCGACGTCGGGGCTCAGAGAACTCAC
CGACCTGTTCGCCAACCAGGGGCTCTCTCAGAAGGACATGGTCGCGCTCTCCGGTAA
GTTGCATGTTGGAACTCAGGCCTAAACTTCTCTCACGCAAGCAACAACAGCAAGCTAATTGAT
TTCCGGCGAGACGCGCACGTACAAGCTAGCTAGCAAAATCAATCAAGCCAGCACTCACGCCAAGCCACACACGAAGATCAATTGATGGCCACAGGCACGTATCGTGCCTGTTTTTTCTCT
TTTTCTATTTTCTGGGATTAGGATAACAAGGCACCGTATGCCCGTACTTATACACGGCCAGAGGCCAGTCCGACTCAACATCTAACAGCCTAACTGAATACGACTAGGAGACCAACTCGT
TGATTCCCCTGTACAACTCCTAAACCGACTAGAACTAGGTATGAACCAGAAATAAACCTATTCGAATTTGACCTTATGCTTACATTCTCCCCCTAAGATCAAAACGAACTTCTACTTGAT
AACGTCGACGCCGATCTTCTTCCTCATCTCCTGAAACTTCAGTCTTCCGAGGGACTTCGTCAATATGTCGGCCAGTTGTTCATCTGTACTGATATAATCAACATCAAGCTTGCCTTCTTC
CACGCATCCTCGTATGTAATGAAACCGGGTGTCGATATGTTTACTTCTATCATGAAACACCGGATTCTTACACAGAGATATAGTGGACTTGTTGTCGATCTTCAACTCAAACTTTTCTGG
TTCTCGGTTTAGTAGATCAGCAAGCAATCGCTCTAGCCACACTCCCTGGCATGCTGCGGTAGCTGCTGCAATGTATTCAGCTTCACACGAGGATAGAGCCACAACCTTCTGCTTCTGTGA
CATCCAGCTCACAATATTTCCACCTAGGAAAAACGCCATGCCCGAAGTACTTTTACGGTCATCAACGTCGCCGGCCATATCACTGTCACTGTACCCGACTAGTTGTGTCTTTTCCTCTTT
CTTCTTTGAGTAAACACACCCATAATTCAGGGTTCCTTTGATGTACCGCAAAATCATCTTCACCGCTGCAAAGTGTTCCGTTGTGGGGTTCTCCATGAATCGACTAACGATCCCAACCGA
GTATGCCAAATCTGGCCTTGTATTCACCAAGTATCTCAGACTTCCCACAATACTTCTATATTCGGTACTTTCAACAGGATCTGCTTCGCTGTGTTTGCTCAATTTATGCCTTGCTTCCAT
CGGTGCTGAGGTAGCATTGCAGTCTTCCATGCCGCACTTCTCAAGGATTTTCCTCGCATAAGCTTCTTGACACAAAGTTATTGAGTCTCCTCGCTGACATACTTCTATCCCGAGGTAGTA
GCTCAATAAACCAAGGTCACTCATCTTGAAAAGATCTAGCATCTGCTTCTTAAATCTTGCAATCTCCCTCTCATCTGCACCCGTGATCAACAGATCATCAACATATACTCCAACTAGGAG
CCGTTCCTTCCCATCACCTCGTTTGTACATAGCATGCTCCAATGGACTCTTCTCAAATCCGAGGGACACCAGTGTAGCATCCAGCTTGGTGTTCCATGCCCTCGGTGCTTGCCGTAGCCC
ATACAATGCCTTGTGCAGTCGCAACACCTTATGTTCCGCCCCCCCTTCGACGAAACCTGGAGGTTGTTGTACATATACTTCTTCTTGTAGGTCACCGTTCAAGAATGCTGATTTCACATC
CATATGATGCAGCTTCCAGGATTCTTGAGCGGCCAAAGCAATCAACAACCGTACCGATTCCATCCTTGCGACTGGAGCGAACACTTCCTCAAAATCAACGCCTTGTTGCTGCACATAGCC
CTTTGCTACCAAGCGTGCTTTGTGCTTTACCACATTGCCATTGGAGTCTTTCTTCACTTTGAATACCCACTTGAGGCCTATGGGTTTATGCCCTGCAGGGAGATCAACCAAGCTCCATGT
CTTGTTATCTTGGATTGATCCCATCTCCTCCTCCATTGCCTTGCGCCAACTTTCTTCCTCGCTAGCTTCTTCAAACGAGGTTGGTTCTTCGGTACTTAACAAGCACCTTTCCTTCGCTGT
GCGCTTCATCTTGACCGTCTTCGTCTTGCGGATCATCTTCTTTGGAGAAGAGTACAACTCCGATAGAGGTCGAAGTCGTTCGGGCGTAGGTCGTCGTCGAGTCCGTGACCGAGTCTGCAC
CGGCGATCGTACCATCGTCGATGCCCTTTGAGAGGTTGCTGCCGCGGTAGAAGTTTCAGCGTCTCCGCCGGCTGCTGCATCCTCCCCTTCACTCGCTCCTGCCGTTTCTCGCGTCGTGGC
AGACGCAGATCTTCCTGCCGCGATTTCTGCCGTGGCAGAATTTTCTGCCGCGGATCCTGCCGCGGGAGGGATTCCTGCCGCTGTTCCTGCCGCGGATCCTGCCGTGGCAGAGGATGAGGC
CGGTGCTCTACTGAAGCTGAACACCGGTGTAGCGCCGTGGCCCGGCGGCGTTCCTGGTGGATCTTCGCCACCTGCGTCATGGTCGTGGCCTTCTCCACGGTTATGACCTGCATGCTCAGG
GACAGGGTAAGATACAACAAACATATCATCCGAATTTTGTTGATTCTCTTCTTTGTTTGAGGACCAATCCCATGCCCTCTCTTCTTCAAAGACGACGTCGCGTGCCACGTGAACTTTTCT
TGTTCGTGGATCGTACACACGATAAGCCTTCGAGTGTCCCTTCAAGCCTGCTTCATAACCCATCAAGATCATCGGCTTACTCCGATCTTCCAGCTTTCCCACATGTCCAGAAACATTCTT
CACATGTGCCATGCACCCAAAAGTACGAAGGTGATCGATCGAAGGTTTTCTTCCACACCAAGCTTCATAGGGTGTCATGCCAATTACACTTTTCGTCGGTGCACGGTTTAGCAAGTATAC
CGCTGTAGTCACCGCTTCTCCCCAAAACCTCCCCGGCAAGCCTTTGCTCTTCATCATGCTTCGAGCCATTGCTACCACGGTTTGGTTTCTTCTTTCAACAACACCGTTTTGCTGCGGTGT
GTATGGGGCTGTCAGAAAACGCTTGATGCCATGTTCCTCACAATATGCAGCAAACTCATGTGAGATGAATTCTCCTCCTCGGTCAGTCCGGAAAGCCTTCAACTTTGCCTCTGCTTCTAC
TTCAGCAGCAATCTTGATCTTCTTGAATGCTTGAAACGCTTGAGCTTTCGTTTTAAGTAGCACAACCCACATGTATCGACTGTAGTCATCTACCACGAGTAGAAAATAGCGATTGCCGGC
TGGGGTTGCAGGTGAAACTGGGCCACACAGATCACCGTGAAACAAATCTAGTACCTTCTCTGCCCGGTACTTTGCTTCTCTGGGAAACGGCGCTCGCCGTTGCTTCCCTACTAGGCATCC
ATCGCACACTTGTTCAACATGATCCACCGTCGGCATCCCAACCACCATGTCCTTCTGGCCGAGTTGTCGAAGTGAGTGAAAATTCAAGTGCCCATAGCGAGCGTGCCACCTCCATGCTGG
ATCATCAAGACCAGCTAGCAAACAGATCGGCTCTGTTCTGTCTAGGTCAAGAATATACAAGCGATTCTTTGCCCTCTTGACCTTCATCAGTAGCTTGCGTTGTCGGTCGTAGCCCCACAG
GTACCCATCCTCTAACACGATTTTACATCCCCTTTCCTCGAGTTGACCAAGACTGATTATATTGCTTTTCAGCTTGGGGATATAATATACGTCGGTTAGTACCTTGTGATCGCCAAATCT
TGTCTCGAAAAGAACTGTGCCTCGCCCTTGTATTGCCACCGTGGAACCATCTCCAAAACGCACCGAGCCACCCACGGCTAGGTTAAGCTCTGCGAATTGGGTTTTGTCGCCAGTCATGTG
ATTGCTAGCGCCCGTGTCAAGGTACCACACATTGCCCGCCTTCACTCTTGCTTTATCATGTAGGTAGACTTTCTTTTCAACAAGGGTTACGGACTCAGACTTCTCCTCGATGACTTCCTC
TTGACCTTCTTCCATCAGCTCGCACATCTCTACCATCAGTAGCGCCGGATCATCATCTTCTTCCCTGGCCATATATGCTTTCTCTTTCTGTGGCTTTCGGCACTCTGACTTGAAGTGCCC
GTATATTCCACAGTTGTGGCACCTAACCTTCTTGCGATCAAACTTTTTCTTGGGGGCCGCACCTTTCTCCTCGGTACCTTGAGGAGCTTTCTTTGCTTGTGCTCGACCTCCTCCTTTAGC
TTGATCTCTTCTTCCACTGGACGATGACGAATCGCCAGTTTTCCTTGCGGCCATAGCAGACCACTGCGCACGGGTCATCATCAGATGCTCGTCATCTTTGCCGTCTCCAAACACCATCCG
GAGTCGTTCATCGTGCGCCTTGTAGCGCCCCACCAAGTCCTCCACCGTGAGGGTTTTCAGATCGACACACTGCTCGATTGAGGTTACGATCTGGATATACTTTGGTGATGCCGCGCGTAG
GAACCGCCTAACCACGGAGATCTCGGAGAGTGTCTCGCCTAGGTCGCGGATCCCGTTAACGAGCGTCCTTACACGCGCTGCGAACGCGTCAACCGCCTCGTCTTCTCCCATCTTCAAACT
CTCATAATTCTTCAGCAAGGTTTGAAGGTTTGCCTCCCGGACACGCTCGTGTCCTTGATGTAGGGTCTTGATCGTATCCCATGCATCCTTCGCAGATTTCTTTCCCTTCAGGTGTTGTAG
CACATCGTTCGGCACAGCCGCATGGATGGCCGCCAACGCCAGGCGATCAATGCGATAGTTCGCCGCTCCTTTGGCGTACGTGTTGCCGCCAGGGTCGACTGCGTCCCAGATCTCTTGAGA
TTCCATAGCCACCTCCATCTTCATTGCCCACATGCTGTAGTCGCTGCGATCGAGCCTTGGAAACGTCGCCGGTGCTGAGTTCCTTCCAGCCGCGGCTCCCGACGTCCCCGCATCCGTCGG
CATAGCTCCCGTGTACTAGGGACCGTTTTGCCGGATTAACCTTGGCTCTGATACCAAATGTTGGAACTCAGGCCTAAACTTCTCTCACGCAAGCAACAACAGCAAGCTAATTGATTTCCG
GCGAGACGCGCACGTACAAGCTAGCTAGCAAAATCAATCAAGCCAGCACTCACGCCAAGCCACACACGAAGATCAATTGATGGCCACAGGCACGTATCGTGCCTGTTTTTTCTCTTTTTC
TATTTTCTGGGATTAGGATAACAAGGCACCGTATGCCCGTACTTATACACGGCCAGAGGCCAGTCCGACTCAACATCTAACAGCCTAACTGAATACGACTAGGAGACCAACTCGTTGATT
CCCCTGTACAACTCCTAAACCGACTAGAACTAGGTATGAACCAGAAATAAACCTATTCGAATTTGACCTTATGCTTACATTGCATGCCTAAATATGTCTACATGTATCCCTATGCACAAA
TAACCTGTCAAAACATTCATATATATTATAACAAGGAAATCCTTCACATGAACGAAGCATTACACATGGTTCACAAATGTTTCAAATTAAAATTTATAAGGATATTTGAGTTCACCATCT
TTGAAATAACTTCCCGTTTCCATGGCCACATGTATACACAGGATCACACACACTAGGCCAGGCGCGCTGCGTGAACTTCGACATCGACAGCGGCTTCGCAGGGACCCATCGATCGAGCTG
CTCCTCCAACTCCGTCTCCGGCGACGGCAACAGCCTTGCACCGCTCGACCTCCAAACCCCCCTCGTCTTCGAGAACAACTACTACAAGAACCTCGTCGACAGAAAGGGGCTCCTCCACTC
CGACCAAGAGCTCTTCAACGGCGGGGTCACCGACCAGCAGGTCCGGTCCTATGTCGACAACCAAAGCGTCTTCTTCGCGGACTTCCTGGCGGGCATGATCAAGTTGGGAGATATCTCGCC
GTTGACGGGCACCAATGGACAGATCAGGAAGAACTGCAGGAGGATTAACTAA

Retrieve as FASTA