Entry information : BdiPrx126 (Bradi4g44530)
Entry ID 7893
Creation 2011-01-17 (Toky Ramarohetra)
Last sequence changes 2011-01-17 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx126 (Bradi4g44530)
Name (synonym) BdiPrx126 (Bradi4g44530)
Class Class III peroxidase    [Orthogroup: Prx008]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx126
start..stop
S start..stop
HvPrx26 539 0 18..329 9..320
TaPrx27 535 0 18..329 19..330
SpPrx08 534 0 29..329 29..329
SbPrx84 533 0 29..329 28..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 47890371..47890610 240 N° 2 47890093..47890284 192 N° 3 47889566..47889731 166 N° 4 47888037..47888428 392
complement(join(47888037..47888428,47889566..47889731,47890093..47890284,4789037 1..47890610))


exon

Literature and cross-references BdiPrx126 (Bradi4g44530)
DNA ref. Phytozome 12:   Bd4 (47890610..47888037)
Protein sequence: BdiPrx126 (Bradi4g44530)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (297)
PWM (Da):   %s   33905.77 (31069.2) Transmb domain:   %s   i7-29o
PI (pH):   %s   6.49 (6.11) Peptide Signal:   %s   cut: 33 range:33-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAGASARSGGGGPCLVLLLVVITAVLAGGSSAQQLSTGFYAYTCPGAMDAVKSVMEAAIAGEPRIGASILRLFFHDCFVQGCDGSLLLDDAPGFQGEKTATPNNGSVRGFEVVDAAKAAVEALCPAIVSCADVLALAARDSVVILGGPSWEVKVGRRDSTTASFAGANNNIPPPASGLANLTALFAQQGLSQKDMVALSGSHTIGQARCTNFRAHIYNDTNIDSGFAGGRRSGCPSTSGSGDNNLAPLDLQTPTTFENNYYKNLVGKKGLLHSDQELFNGGTTDPQVQSYVSSQSTFFADFVTGMIKMGDISPLTGNNGQIRKNCRRTN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, 3 introns), no EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGGTGCAAGTGCAAGAAGCGGCGGCGGCGGCCCGTGCTTGGTCCTGCTGCTCGTGGTGATCACGGCGGTCCTCGCCGGCGGGTCGTCGGCGCAGCAGCTGTCGACGGGGTTCTAC
GCCTACACGTGCCCGGGCGCCATGGACGCCGTGAAGAGCGTGATGGAGGCCGCCATCGCCGGGGAGCCCCGCATCGGCGCCTCCATCCTCCGCCTCTTCTTCCACGACTGCTTCGTCCAA
GTACTTAACTCATAATAAATAATTGATCCTTAATTCTTGCACTGGTCTGTGATCGAATCAATGAATCAATGTTCTTAATCGATTAGGGTTGTGACGGGTCGCTGCTGCTAGACGACGCGC
CGGGCTTCCAGGGGGAGAAGACGGCGACGCCCAACAACGGTTCGGTGCGCGGGTTCGAGGTGGTGGACGCCGCTAAGGCCGCCGTCGAGGCGCTCTGCCCCGCCATCGTCTCCTGCGCCG
ACGTGCTCGCCCTCGCCGCCAGGGACAGCGTCGTCATC
GTAGGCACTTTAACCTTTGCTACACTCCGTTCCCAAACTCCCTCCATTCCATAATTCTCGTTGAAATAAGACAAGGAACGAA
GGTAGTATAAGAAGTCATATAGCTAATTCTGTGGTTAATTTATAGAAAAATCTACTGAGATCTACAATATCAAATGAATGTAGTGACATGTTTAATAAAACTAATTTGAAGTTCTCGATG
ATTGTAGACTTTTCTAGGAATTCGGTCAAACTTGAATAAGTTTGAGTTAAGAAAAAACTAGGTAGTATGTACTTTGCATGCATTAATTGCAACTCCATGCTGAAACTAATTAACGACGAT
GGATGACCTGACATGTGTGATGTGTGTATGTGTGTGTAGCTGGGTGGTCCGAGCTGGGAGGTGAAGGTCGGACGGCGGGACTCGACGACGGCGAGCTTTGCCGGCGCCAACAACAACATC
CCGCCGCCGGCGTCCGGCCTCGCCAACCTCACGGCGCTCTTCGCCCAACAAGGGCTCTCCCAGAAGGACATGGTCGCCCTCTCCG
GTACGTACTACAGTAAAATGTATTTATTTATTTAT
TTATTCATTGACATATCATTAAATGGTAACCCTAAGTCCCTAATTAATTAAAGAAGAAGCACAAAGTACTCCAGCACACATGATTAGTTAATTATGCTTGATCTCGATCGATCTGGTGTG
ATAAAGAACTGTACAGAAAGGAAAGGGAAAAGGCTAGGGCCGGGAATGGAATCGATTCCTCATTCTAGGGGGAAAAGAAGACCATTTTCACACTCTCTGCTAGCTTCTCCGGGCAGCTTT
GGCTGAGAAATCTAGACTACCTGGAGTAGCTAACTAAGCTGTGGCTGCCGTACTAGCGAAGTTTTGACTTGAAAGCCTAACTAGATTAGCATGATTAGTTCATTTACTGACTGCTGACGA
GTCTAGCATGCATAATTGGACCGGTAACTACTCCCAGAATGTGTCGTTATTCTCTGCCGACTAATCAAGAAATTGACCTACCCTATCTGGGCAACTTTTTCTTCCTCGAAGAAAAATGGC
ACCAAGTTGGTAGAGCTAGCTAGCTACGGCCAGCTTGCATGCATGGCTGTCGGTGTAGGTTCGTAGGTGGACAAAGTTACTCCCTCCGATGGTCGAAATATTACATGTATCTAAACGTTT
TATAGTCATAGATACATTAATATTTGGGCAAATTTGAGACAATCAAAATATGGTTGGGAGGGATCGAGCAGTAGTTCTTCCATGCACATGTTAAACCTGACGCCGAGCAACATGCTATTT
TCAATGACATGTTGCTGGCTTTTATTAGTTTGAAAGATATGATTTGGACAAATACAATCTAAAAGCATGCATAAAGCTAATCGGCATTGATCCGCGGATAAACCCACTTGATTAATTGCA
AGCTAATCACGACCACACATGCATGCATATATACGATTCCTTTTGCTCTCTGTTCCATGTGACTTGACTCAATGCCTTTCTTTCTTTCTTCCCATTTTAGCTAATTAAAGTGCCTAAAGA
TTCATTTATTCTCACGAAGGAAATGAAGGGTCCTAGTGACCTGACAAATGTAACAAAAATGAGGACATTTTAAGTCCATCGTTTTTAACACTCTCACGGAAATTAATTTATTTCCTCATC
AAATTGTACATCATATATACAGGATCTCACACCATAGGCCAAGCACGCTGCACAAACTTCCGAGCCCACATCTACAACGACACCAACATCGACAGCGGCTTCGCAGGGGGCCGTCGATCG
GGCTGCCCCTCCACCTCCGGCTCCGGCGACAACAACCTAGCGCCGCTTGATCTCCAGACCCCGACCACCTTCGAGAACAACTACTACAAGAACCTTGTCGGCAAAAAAGGGCTCCTGCAT
TCTGACCAGGAGCTCTTCAATGGCGGCACCACCGACCCACAAGTACAGTCCTACGTCAGCAGCCAGAGCACCTTCTTCGCGGACTTTGTGACGGGCATGATCAAGATGGGCGACATCTCG
CCGTTGACGGGGAACAATGGACAGATCAGGAAGAACTGCAGGAGGACAAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGGTGCAAGTGCAAGAAGCGGCGGCGGCGGCCCGTGCTTGGTCCTGCTGCTCGTGGTGATCACGGCGGTCCTCGCCGGCGGGTCGTCGGCGCAGCAGCTGTCGACGGGGTTCTAC
GCCTACACGTGCCCGGGCGCCATGGACGCCGTGAAGAGCGTGATGGAGGCCGCCATCGCCGGGGAGCCCCGCATCGGCGCCTCCATCCTCCGCCTCTTCTTCCACGACTGCTTCGTCCAA
GGTTGTGACGGGTCGCTGCTGCTAGACGACGCGCCGGGCTTCCAGGGGGAGAAGACGGCGACGCCCAACAACGGTTCGGTGCGCGGGTTCGAGGTGGTGGACGCCGCTAAGGCCGCCGTC
GAGGCGCTCTGCCCCGCCATCGTCTCCTGCGCCGACGTGCTCGCCCTCGCCGCCAGGGACAGCGTCGTCATC
CTGGGTGGTCCGAGCTGGGAGGTGAAGGTCGGACGGCGGGACTCGACG
ACGGCGAGCTTTGCCGGCGCCAACAACAACATCCCGCCGCCGGCGTCCGGCCTCGCCAACCTCACGGCGCTCTTCGCCCAACAAGGGCTCTCCCAGAAGGACATGGTCGCCCTCTCCG
GA
TCTCACACCATAGGCCAAGCACGCTGCACAAACTTCCGAGCCCACATCTACAACGACACCAACATCGACAGCGGCTTCGCAGGGGGCCGTCGATCGGGCTGCCCCTCCACCTCCGGCTCC
GGCGACAACAACCTAGCGCCGCTTGATCTCCAGACCCCGACCACCTTCGAGAACAACTACTACAAGAACCTTGTCGGCAAAAAAGGGCTCCTGCATTCTGACCAGGAGCTCTTCAATGGC
GGCACCACCGACCCACAAGTACAGTCCTACGTCAGCAGCCAGAGCACCTTCTTCGCGGACTTTGTGACGGGCATGATCAAGATGGGCGACATCTCGCCGTTGACGGGGAACAATGGACAG
ATCAGGAAGAACTGCAGGAGGACAAATTAA

Retrieve as FASTA