Entry information : BdiAPx06 (Bradi5g03640)
Entry ID 7894
Creation 2011-01-17 (Toky Ramarohetra)
Last sequence changes 2011-01-17 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-01-19 (Toky Ramarohetra (Scipio))
Peroxidase information: BdiAPx06 (Bradi5g03640)
Name (synonym) BdiAPx06 (Bradi5g03640)
Class Ascorbate peroxidase    [Orthogroup: APx005]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type Flowers
Inducers Abiotic stress
Drought
Repressor N/D
Best BLASTp hits
Perox score E-value BdiAPx06
start..stop
S start..stop
OsAPx03 478 6e-173 3..293 2..290
SiAPx10 472 2e-170 1..293 1..291
SbAPx03 462 2e-166 5..293 3..289
ZmAPx03 460 1e-165 5..293 3..289
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4449330..4449448 119 N° 2 4449110..4449234 125 N° 3 4448907..4449022 116 N° 4 4448766..4448814 49
N° 5 4448552..4448634 83 N° 6 4448377..4448456 80 N° 7 4447788..4447890 103 N° 8 4447500..4447709 210
complement(join(4447500..4447709,4447788..4447890,4448377..4448456,4448552..4448 634,4448766..4448814,4448907..4449022,4449110..4449234,4449330..4449448))


exon

Literature and cross-references BdiAPx06 (Bradi5g03640)
Literature Lucas,S., Rokhsar,D., Wang,M., Lindquist,E.A., Fox,S.E., Vogel,J.,
Bragg,J.N., McKenzie,N., Bevan,M.W., Garvin,D., Michael,T., Hazen,S., Chang,J., Laudencia-Chingcuanco,D., Weng,Y. and Mockler,T.
DOE Joint Genome Institute Brachypodium distachyon EST project.
Unpublished (2009).
DNA ref. Phytozome 12:   Bd5 (4449448..4447500)
EST ref. GenBank:   GT817436.1 [5' end]   GT799467.1 [3' end]
Protein sequence: BdiAPx06 (Bradi5g03640)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   294
PWM (Da):   %s   31965.58 Transmb domain:   %s   i265-287o
PI (pH):   %s   9.14
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSVAPVVNAEYMAEIDKARRDLRALIASKSCAPIMLRLAWHDAGTYDKKTNTGGPNGSIRFPEEHSHAANAGLKVAIDLEPIKQKHPKITYADLYQLAGVVAVEVTGGPTIDFVPGRDSSVCPEEGRLPDAKQGAAHLRDVFYRMGLSDKDIVALSGGHTGKARPDRSGFDGAWTKDPLKFDNSYFVELLKGETDGLLKLPTDKVLVEDPVFRRYVELYADEDAFFRDYAESHKKLSELGFKPPRAAALAYKSSGGNMKGLLTRTATMVAVAAAVVAWAYLHGPNKKLD*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, 7 introns), 5 ESTs. Strain="Bd21".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTCGGTGGCACCGGTGGTGAACGCAGAGTACATGGCGGAGATCGACAAGGCGCGGCGGGACCTCCGTGCGCTCATCGCCAGCAAGAGCTGCGCTCCCATCATGCTCCGCCTCGCG
TACTTACGATTCTCACAGCCATAGCATTTCTCGCTTAAGCAATGTTGGTTGTCAGGTTTTGATTAGAAATTTTCTCGCTTGATCATGGGTGCAGATGGCATGATGCTGGCACCTACGACA
AGAAGACCAACACCGGAGGGCCCAACGGCTCGATCAGGTTCCCGGAGGAGCACAGCCACGCTGCAAATGCAGGGCTCAAGGTCGCCATCGACCTTCTAG
GTTGGCCAGCACTTATAATTT
TTGAAGTAGTGATTTTCAAGCAGTCTGATGCTCGTAAATAAACCTTTCCAATTCCCTGTGTTGCAGAACCGATTAAGCAAAAGCACCCCAAGATCACATATGCAGACCTCTACCAGCTTG
CCGGAGTTGTGGCCGTTGAAGTCACCGGTGGACCAACAATAGATTTCGTTCCTGGCAGGAGG
GTAAGTTAACAGAAACAATGTCGTTTCCTTATTACAGAACCAAGCATCCTAGTCTAAG
CATCTTAGTTTCGCTTTTCGCGTATGTATACCAGGATTCTTCAGTTTGCCCGGAGGAAGGACGCTTGCCAGATGCTAAGCAAGGTAACCAGGTGCATTCCTTTTATTATTAATTTATTAT
GTATTTTATAATTTGGAACAGAGGTTGTAATTTTGAACCGGTGAACTTTTAGTGTGGTAAAAATGTTGCATTCTTTCTGTTATCATGTCACAAGGTGCTGCACACCTGAGGGATGTCTTC
TACCGGATGGGTTTGTCTGACAAAGACATCGTAGCACTCTCCGGTGGCCATACTCTG
GTAATGCAACAAACATCTTGTTCACATAACGGTTCATCAGCAACCCCCATTTCTTTTGCTGAC
AAGTTCTTGTTCTGCATTTCACACATTCTCAGGGGAAGGCACGTCCGGATAGATCGGGATTCGACGGTGCTTGGACAAAGGATCCTCTTAAGTTCGACAACTCTTATTTTGTGTAAGATT
AAACACAACATATTCATCGAATGCTCATTAGTTTCAGACTGTAGAGTATAATTAATGCCACCACAACATTAATCAGGAGTTCCTAAGTATATTTGTCGTCTCTCAACTTGTTGAAAAGTA
CGCAAACCAGACATCAATGGTCCATCGCCGCATCCAAAGTGGTATTAGTGTCATCTCACCATGGTTTTGGCCTAGCAATTATCATGTTAGCCTGTCAAATTGGCATCACTTTTCGTTTTT
TTGCCTCGAGTCAAATTGGTTCCACCAAAGAAACCTAAGCCAGTATGGTAATTCAAGGCCAGAACCATAACATATCAGCACTAATACCACTTCAAATGAGGGGAAAAATCATTGTTGTCC
GGTTCGATAATCGAGGGACTAAAAGTGTATGAAAAAAATTGAGACACTATTTGCATACTTTTCAACAAATTGAGAGACAAAAAATATATTTTTCTCAATATAATTACATATGCTGCAGTG
AGCTTCTGAAAGGGGAAACTGATGGGCTCCTGAAGCTGCCTACGGACAAGGTTCTCGTGGAAGACCCCGTTTTCCGCCGGTATGTGGAACTATATGCCAAG
GTACACCAGAGTTCAGATG
GGGAGTTCTTCAGACCCATGCCGCCTAGCTACAACTGACAACTTATTTTGCGCATGCAGGACGAGGACGCCTTCTTCAGGGACTATGCGGAGTCGCACAAAAAGCTCTCCGAGCTCGGCT
TCAAGCCTCCTCGCGCTGCTGCTCTGGCGTACAAATCGTCCGGAGGCAACATGAAGGGATTACTGACGAGAACTGCAACCATGGTAGCGGTTGCTGCTGCTGTCGTGGCTTGGGCTTACC
TACACGGACCCAACAAGAAGCTTGACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTCGGTGGCACCGGTGGTGAACGCAGAGTACATGGCGGAGATCGACAAGGCGCGGCGGGACCTCCGTGCGCTCATCGCCAGCAAGAGCTGCGCTCCCATCATGCTCCGCCTCGCA
TGGCATGATGCTGGCACCTACGACAAGAAGACCAACACCGGAGGGCCCAACGGCTCGATCAGGTTCCCGGAGGAGCACAGCCACGCTGCAAATGCAGGGCTCAAGGTCGCCATCGACCTT
CTAG
AACCGATTAAGCAAAAGCACCCCAAGATCACATATGCAGACCTCTACCAGCTTGCCGGAGTTGTGGCCGTTGAAGTCACCGGTGGACCAACAATAGATTTCGTTCCTGGCAGGAGG
GATTCTTCAGTTTGCCCGGAGGAAGGACGCTTGCCAGATGCTAAGCAAGGTGCTGCACACCTGAGGGATGTCTTCTACCGGATGGGTTTGTCTGACAAAGACATCGTAGCACTCTCCGGT
GGCCATACTCTG
GGGAAGGCACGTCCGGATAGATCGGGATTCGACGGTGCTTGGACAAAGGATCCTCTTAAGTTCGACAACTCTTATTTTGTTGAGCTTCTGAAAGGGGAAACTGATGGG
CTCCTGAAGCTGCCTACGGACAAGGTTCTCGTGGAAGACCCCGTTTTCCGCCGGTATGTGGAACTATATGCCAAG
GACGAGGACGCCTTCTTCAGGGACTATGCGGAGTCGCACAAAAAG
CTCTCCGAGCTCGGCTTCAAGCCTCCTCGCGCTGCTGCTCTGGCGTACAAATCGTCCGGAGGCAACATGAAGGGATTACTGACGAGAACTGCAACCATGGTAGCGGTTGCTGCTGCTGTC
GTGGCTTGGGCTTACCTACACGGACCCAACAAGAAGCTTGACTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCCTTTTCTT CCTACAAAAC TGCGCCGCTT TTCCTATCCT TCACCAACAA CTCCAACGTA GAGCTTGCTC TGTTTCCTTC CAAAGAGATC TCGAGTAAGC AATTAACTGC GCACAAAGAT  GTCGTCGGTG GCACCGGTGG TGAACGCAGA GTACATGGCG GAGATCGACA AGGCGCGGCG GGACCTCCGT GCGCTCATCG CCAGCAAGAG CTGCGCTCCC ATCATGCTCC GCCTCGCATG  GCATGATGCT GGCACCTACG ACAAGAAGAC CAACACCGGA GGGCCCAACG GCTCGATCAG GTTCCCGGAG GAGCACAGCC ACGCTGCAAA TGCAGGGCTC AAGGTCGCCA TCGACCTTCT  AGAACCGATT AAGCAAAAGC ACCCCAAGAT CACATATGCA GACCTCTACC AGCTTGCCGG AGTTGTGGCC GTTGAAGTCA CCGGTGGACC AACAATAGAT TTCGTTCCTG GCAGGAGGGA  TTCTTCAGTT TGCCCGGAGG AAGGACGCTT GCCAGATGCT AAGCAAGGTG CTGCACACCT GAGGGATGTC TTCTACCGGA TGGGTTTGTC TGACAAAGAC ATCGTAGCAC TCTCCGGTGG  CCATACTCTG GGGAAGGCAC GTCCGGATAG ATCGGGATTC GACGGTGCTT GGACAAAGGA TCCTCTTAAG TTCGACAACT CTTATTTTGT TGAGCTTCTG AAAGGGGAAA CTGATGGGCT  CCTGAAGCTG CCTACGGACA AGGTTCTCGT GGAAGACCCC GTTTTCCGCC GGTATGTGGA ACTATATGCC AAGGACGAGG ACGCCTTCTT CAGGGACTAT GCGGAGTCGC ACAAAAAGCT  CTCCGAGCTC GGCTTCAAGC CTCCTCGCGC TGCTGCTCTG GCGTACAAAT CGTCCGGAGG CAACATGAAG GGATTACTGA CGAGAACTGC AACCATGGTA GCGGTTGCTG CTGCTGTCGT  GGCTTGGGCT TACCTACACG GACCCAACAA GAAGCTTGAC TGATTCCATC TGTACATCGT CACGATTCCT CTTACTCTGT GATGGGTGCT GGGAAACAAA GTTAACGTTC AGATTTGTCC  AATTGTGTGT CTGTACATGG ACTGTGAATG TTGTGTTTGT GATGTCGCAC AGAAATGAAA TAAGATAATT TGCAGTTGTA TGAGGAATCA ATTATGTTTC AAGTTATAAA CAACACTTCT 
TTTTA 

Retrieve as FASTA