Entry information : BdiPrx128 (Bradi5g10070)
Entry ID 7895
Creation 2011-01-17 (Toky Ramarohetra)
Last sequence changes 2011-01-17 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx128 (Bradi5g10070)
Name (synonym) BdiPrx128 (Bradi5g10070)
Class Class III peroxidase    [Orthogroup: Prx128]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx128
start..stop
S start..stop
OsPrx54 543 0 23..330 34..343
ZmPrx19 538 0 4..330 5..338
SiPrx12 535 0 29..330 41..343
SbPrx91 534 0 28..330 44..347
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 13312690..13313272 583 N° 2 13313417..13313838 422  
join(13312690..13313272,13313417..13313838)


exon

Literature and cross-references BdiPrx128 (Bradi5g10070)
DNA ref. Phytozome 12:   Bd5 (13312690..13313838)
EST ref. GenBank:   DV486315.1 [3' end]   DV487372.1 [Fragment]
Protein sequence: BdiPrx128 (Bradi5g10070)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   334 (309)
PWM (Da):   %s   35938.93 (33615.7) Transmb domain:   %s   i7-29o
PI (pH):   %s   6.98 (6.94) Peptide Signal:   %s   cut: 26 range:26-334
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALHWSSGLAALAVAVSLFAAGAAGHPFLVPQFYEHTCPQMQAVVGGIVAKEHAKDPRMAASLVRLHFHDCFVQGCDASVLLDDAHGRFTTEKRSNPNRDSLRGYEVIDEIKAALEHACPGTVSCADIVAVAARDSTVLTGGPGWEVPLGRRDSLTASLSGSNNLIPAPNDTLPTIAAKFHNQGLDIVDLVALSGAHTIGDSRCVSFRQRLYNQNNDGRPDPTLNPAYAAELRGRCPKSGGDQTLFALDPATQFRFDNQYYKNILAMNGLLNSDEVLLTQSHETMELVKSYAASNALFFEHFARSMVKMGNISPLTGHSGEIRKNCRRISTTSN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, intron 3), 1 EST. Cultivar="Bd21".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCACTGCACTGGAGCAGCGGCCTGGCGGCGCTCGCTGTCGCCGTGTCGCTCTTCGCGGCGGGCGCCGCGGGCCACCCGTTCCTGGTGCCGCAGTTCTACGAGCACACGTGCCCGCAG
ATGCAGGCGGTGGTGGGCGGCATCGTGGCCAAGGAGCACGCCAAGGACCCGCGCATGGCGGCGTCCCTGGTCCGGCTGCACTTCCACGACTGCTTCGTGCAGGGCTGCGACGCGTCCGTG
CTGCTGGACGACGCCCACGGCAGGTTCACCACCGAGAAGCGGTCCAACCCGAACCGCGACTCGCTGCGAGGGTACGAGGTCATCGACGAGATCAAGGCCGCGCTCGAGCACGCCTGCCCC
GGCACCGTCTCCTGCGCCGACATCGTCGCCGTCGCCGCCAGGGACTCCACCGTGCTGACTGGTGGGCCCGGCTGGGAGGTGCCGCTGGGGAGGAGGGACTCGCTCACCGCCAGCCTGAGC
GGCTCCAACAACCTCATCCCTGCCCCCAACGACACCCTCCCCACCATCGCCGCCAAGTTCCACAACCAGGGGCTCGACATCGTCGACCTCGTCGCCCTCTCAG
GTATATACATGCCATTG
CACATGAACAGAATGGTCACAGGAATTACTCTCTTCGATCCATATTACTCGTGTATCTAGACAAAACTGCGACCAGTAGAGTTACAAGTTACGTAACGAATTAATGGACGGCGTTTCGGG
CATGCAGGGGCGCACACGATCGGCGACTCGCGGTGCGTGAGCTTCAGGCAGCGGCTGTACAACCAGAACAACGACGGGCGGCCGGACCCGACGCTAAACCCGGCGTACGCGGCGGAGCTC
CGCGGGCGGTGCCCCAAGTCCGGCGGCGACCAGACCCTGTTCGCGCTCGACCCGGCAACCCAGTTCCGGTTCGACAACCAGTACTACAAGAACATCCTGGCCATGAACGGCCTGCTCAAC
TCCGACGAGGTGTTGCTCACGCAGAGCCACGAGACCATGGAGCTCGTCAAGAGCTACGCCGCCAGCAACGCGCTCTTCTTCGAGCACTTCGCCAGGTCCATGGTCAAGATGGGCAACATC
TCGCCCCTCACCGGGCACAGCGGCGAGATCAGGAAGAACTGCAGGAGGATATCAACCACTTCTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCACTGCACTGGAGCAGCGGCCTGGCGGCGCTCGCTGTCGCCGTGTCGCTCTTCGCGGCGGGCGCCGCGGGCCACCCGTTCCTGGTGCCGCAGTTCTACGAGCACACGTGCCCGCAG
ATGCAGGCGGTGGTGGGCGGCATCGTGGCCAAGGAGCACGCCAAGGACCCGCGCATGGCGGCGTCCCTGGTCCGGCTGCACTTCCACGACTGCTTCGTGCAGGGCTGCGACGCGTCCGTG
CTGCTGGACGACGCCCACGGCAGGTTCACCACCGAGAAGCGGTCCAACCCGAACCGCGACTCGCTGCGAGGGTACGAGGTCATCGACGAGATCAAGGCCGCGCTCGAGCACGCCTGCCCC
GGCACCGTCTCCTGCGCCGACATCGTCGCCGTCGCCGCCAGGGACTCCACCGTGCTGACTGGTGGGCCCGGCTGGGAGGTGCCGCTGGGGAGGAGGGACTCGCTCACCGCCAGCCTGAGC
GGCTCCAACAACCTCATCCCTGCCCCCAACGACACCCTCCCCACCATCGCCGCCAAGTTCCACAACCAGGGGCTCGACATCGTCGACCTCGTCGCCCTCTCAG
GGGCGCACACGATCGGC
GACTCGCGGTGCGTGAGCTTCAGGCAGCGGCTGTACAACCAGAACAACGACGGGCGGCCGGACCCGACGCTAAACCCGGCGTACGCGGCGGAGCTCCGCGGGCGGTGCCCCAAGTCCGGC
GGCGACCAGACCCTGTTCGCGCTCGACCCGGCAACCCAGTTCCGGTTCGACAACCAGTACTACAAGAACATCCTGGCCATGAACGGCCTGCTCAACTCCGACGAGGTGTTGCTCACGCAG
AGCCACGAGACCATGGAGCTCGTCAAGAGCTACGCCGCCAGCAACGCGCTCTTCTTCGAGCACTTCGCCAGGTCCATGGTCAAGATGGGCAACATCTCGCCCCTCACCGGGCACAGCGGC
GAGATCAGGAAGAACTGCAGGAGGATATCAACCACTTCTAATTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CATCCATCAT CTCTAGCGCG ATTGACCCAG CTCGCCATTA GGAGATGGCA CTGCACTGGA GCAGCGGCCT GGCGGCGCTC GCTGTCGCCG TGTCGCTCTT CGCGGCGGGC GCCGCGGGCC  ACCCGTTCCT GGTGCCGCAG TTCTACGAGC ACACGTGCCC GCAGATGCAG GCGGTGGTGG GCGGCATCGT GGCCAAGGAG CACGCCAAGG ACCCGCGCAT GGCGGCGTCC CTGGTCCGGC  TGCACTTCCA CGACTGCTTC GTGCAGGGCT GCGACGCGTC CGTGCTGCTG GACGACGCCC ACGGCAGGTT CACCACCGAG AAGCGGTCCA ACCCGAACCG CGACTCGCTG CGAGGGTACG  AGGTCATCGA CGAGATCAAG GCCGCGCTCG AGCACGCCTG CCCCGGCACC GTCTCCTGCG CCGACATCGT CGCCGTCGCC GCCAGGGACT CCACCGTGCT GACTGGTGGG CCCGGCTGGG  AGGTGCCGCT GGGGAGGAGG GACTCGCTCA CCGCCAGCCT GAGCGGCTCC AACAACCTCA TCCCTGCCCC CAACGACACC CTCCCCACCA TCGCCGCCAA GTTCCACAAC CAGGGGCTCG  ACATCGTCGA CCTCGTCGCC CTCTCAGGGG CGCACACGAT CGGCGACTCG CGGTGCGTGA GCTTCAGGCA GCGGCTGTAC AACCAGAACA ACGACGGGCG GCCGGACCCG ACGCTAAACC  CGGCGTACGC GGCGGAGCTC CGCGGGCGGT GCCCCAAGTC CGGCGGCGAC CAGACCCTGT TCGCGCTCGA CCCGGCAACC CAGTTCCGGT TCGACAACCA GTACTACAAG AACATCCTGG  CCATGAACGG CCTGCTCAAC TCCGACGAGG TGTTGCTCAC GCAGAGCCAC GAGACCATGG AGCTCGTCAA GAGCTACGCC GCCAGCAACG CGCTCTTCTT CGAGCACTTC GCCAGGTCCA  TGGTCAAGAT GGGCAACATC TCGCCCCTCA CCGGGCACAG CGGCGAGATC AGGAAGAACT GCAGGAGGAT ATCAACCACT TCTAATTAAA CAGTGGTCCT CTTTTGATTT CGGAATTCCT  TTTGATTTGC GTGTTTCCTT CAAGTATGTA TGCGTGTGAT TACTTGCATT TTGGTATTCG GGGTCATGCA CCGTAAATGG TTGCGGTCGT TTTTTCTTCC CTCTTGTAAT TGTTCATATT 
TCATCTTTGC TGTCAATAAA GTGCTTATCG GATGTTCCTG TCA 

Retrieve as FASTA