Entry information : BdiPrx132 (Bradi5g22650)
Entry ID 7897
Creation 2011-01-17 (Toky Ramarohetra)
Last sequence changes 2011-01-17 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx132 (Bradi5g22650)
Name (synonym) BdiPrx132 (Bradi5g22650)
Class Class III peroxidase    [Orthogroup: Prx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx132
start..stop
S start..stop
OsPrx56 598 0 1..328 1..328
SiPrx50 541 0 1..328 1..347
SbPrx94 535 0 1..328 4..347
ZmPrx140 522 0 1..328 1..352
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 24940123..24940338 216 N° 2 24940414..24940602 189 N° 3 24940890..24941058 169 N° 4 24941556..24941983 428
join(24940123..24940338,24940414..24940602,24940890..24941058,24941556..24941983 )


exon

Literature and cross-references BdiPrx132 (Bradi5g22650)
DNA ref. Phytozome 12:   Bd5 (24940123..24941983)
Protein sequence: BdiPrx132 (Bradi5g22650)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   333 (317)
PWM (Da):   %s   36614.5 (34705.4)  
PI (pH):   %s   8.21 (8.01) Peptide Signal:   %s   cut: 23 range:17-333
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLYRLLFGFALPFVLQSSLVLSNPSGVRVGFYKYTCPNAEVIIRDEMTKIISGVPSLAGPLLRMHFHDCFVNGCDGSILLNSTPGSPSEKESIPNLTLRGFGTIDLVKSKLEQACPGVVSCADILALVARDVVLLTKGPHWDVPTGRRDGMRSAKEDALNNLPPPFFDATQNLNQFFIPKGLDAKDQVVLLGGHTLGTSHCSSFSDRLYNFSGTHMADPMLDKQYTRRLKTKCKPNDTTTLVEMDPGSFRTFDTSYYRVIAKGRALFTSDETLMLDPFTRDYVLRQAGVAGYPAEFFADFAASMVKMGNMQVLTGAQGEIRKHCAFVNKMHIL

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, intron 1, 2 and 3), no EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTTACAGACTCCTCTTTGGATTTGCACTTCCTTTTGTCCTACAATCCTCCTTAGTGTTGAGCAATCCATCAGGGGTGAGGGTTGGCTTTTACAAATACACATGTCCGAATGCAGAG
GTCATTATACGTGATGAGATGACCAAGATCATCTCTGGTGTCCCAAGCCTTGCTGGCCCACTGCTTCGCATGCACTTCCATGACTGCTTTGTGAAT
GTGTGTAGATATCTGACTGTGTTC
CAAGCTTATTCAGTACTTCAGAGATGTTACTAAATTTCTTGTTCTCTGCAGGGTTGTGATGGTTCTATTCTGCTGAATAGCACACCAGGATCACCATCTGAAAAGGAATCAATACCGAAC
CTCACCCTCCGGGGCTTTGGTACAATTGACCTTGTCAAGTCTAAGCTAGAGCAAGCCTGCCCTGGGGTGGTCTCCTGCGCTGATATCCTAGCTCTTGTAGCAAGGGATGTTGTACTACTG
GTAAGAACTAAGAACTAGCATTCCTGTTAACTAATCTTGGTCCTTTGTTTAAGTAAGATAAATTGACATGTTTTAGGAAATTGGGGGGAATAGGCTGGGCTGGTTCAGGCCAGCAATGGT
GGTAAACCCACTCAGTTTTAACCTTCAGCTGAATTTGACCATCTTTTATGTAATTACTGGACAGTACTGTCTCTCCCGCTGCTGACAATGACTGGAGTTGGACCTTTTTTCTTTGAAATT
ATGACTGGAGTTGAACCTAGATTTATGACCTTTTTATTATGCAACAGACCAAAGGGCCTCATTGGGATGTTCCAACTGGGCGGAGAGACGGAATGAGATCGGCGAAGGAAGATGCTTTGA
ACAATCTGCCTCCACCCTTTTTTGATGCCACTCAAAACCTGAATCAGTTCTTCATTCCTAAGGGCCTTGATGCAAAGGATCAGGTGGTTCTGCTAG
GTATAAACTACTGCATCTCTTTTT
AGTTTATTTGAACTTTGCTGATCCCAACAAATCTCCAGTTGCAGTCTCCCCATAAAGGTGTTGTTTGTATACACTACTAAGCAACTTGTTAATCAAGCAAAGGTGGTGTATGCATTTACC
AGGTCAACAGAGATGGGAAAAGACAAACTATGTCGTTTCCATTCCTAGTTATATTACACCATACAAAACCAAGGGTCGTCATTGTCTTTTAGAAAAACAAATCATACCTTTATATACGAG
AATTAGTACATTTCATTCCTTTGTTGGCCATAACGACACTTATTTTGCACACGCAGATGAAAAGGAGAAGAAACCTCTATAGCTCATTTGTCCTTTGCAATTTCATTTTTGATTATCTCA
CATCCACAGAACATATATATGACTAAAATTTCTGACGCTGCAAATTTTGCGATTCAAACTCAGTAGGAAGCCATGGAAACTGACACGCACTATCTTTGTTCACGCATTGACAGGGGGGCA
CACCCTTGGGACCTCCCACTGCTCTTCGTTCTCGGACCGGCTGTACAACTTCAGCGGCACGCACATGGCCGACCCAATGCTGGACAAGCAGTACACCCGGCGCCTGAAAACCAAGTGCAA
GCCCAACGACACGACGACGCTGGTGGAGATGGACCCTGGGAGCTTCAGGACGTTTGACACGAGCTACTACCGTGTCATTGCCAAGGGCAGGGCGCTCTTCACCTCTGACGAGACGCTCAT
GCTCGACCCTTTCACCAGGGACTACGTGCTGCGGCAGGCGGGCGTCGCCGGCTACCCAGCTGAGTTCTTCGCAGACTTCGCGGCGTCCATGGTGAAGATGGGGAACATGCAGGTGCTCAC
CGGCGCACAGGGGGAGATCAGGAAGCACTGCGCCTTTGTGAATAAGATGCACATATTATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTTACAGACTCCTCTTTGGATTTGCACTTCCTTTTGTCCTACAATCCTCCTTAGTGTTGAGCAATCCATCAGGGGTGAGGGTTGGCTTTTACAAATACACATGTCCGAATGCAGAG
GTCATTATACGTGATGAGATGACCAAGATCATCTCTGGTGTCCCAAGCCTTGCTGGCCCACTGCTTCGCATGCACTTCCATGACTGCTTTGTGAAT
GGTTGTGATGGTTCTATTCTGCTG
AATAGCACACCAGGATCACCATCTGAAAAGGAATCAATACCGAACCTCACCCTCCGGGGCTTTGGTACAATTGACCTTGTCAAGTCTAAGCTAGAGCAAGCCTGCCCTGGGGTGGTCTCC
TGCGCTGATATCCTAGCTCTTGTAGCAAGGGATGTTGTACTACTG
ACCAAAGGGCCTCATTGGGATGTTCCAACTGGGCGGAGAGACGGAATGAGATCGGCGAAGGAAGATGCTTTGAAC
AATCTGCCTCCACCCTTTTTTGATGCCACTCAAAACCTGAATCAGTTCTTCATTCCTAAGGGCCTTGATGCAAAGGATCAGGTGGTTCTGCTAG
GGGGGCACACCCTTGGGACCTCCCAC
TGCTCTTCGTTCTCGGACCGGCTGTACAACTTCAGCGGCACGCACATGGCCGACCCAATGCTGGACAAGCAGTACACCCGGCGCCTGAAAACCAAGTGCAAGCCCAACGACACGACGACG
CTGGTGGAGATGGACCCTGGGAGCTTCAGGACGTTTGACACGAGCTACTACCGTGTCATTGCCAAGGGCAGGGCGCTCTTCACCTCTGACGAGACGCTCATGCTCGACCCTTTCACCAGG
GACTACGTGCTGCGGCAGGCGGGCGTCGCCGGCTACCCAGCTGAGTTCTTCGCAGACTTCGCGGCGTCCATGGTGAAGATGGGGAACATGCAGGTGCTCACCGGCGCACAGGGGGAGATC
AGGAAGCACTGCGCCTTTGTGAATAAGATGCACATATTATAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTTACA GACTCCTCTT TGGATTTGCA CTTCCTTTTG TCCTACAATC CTCCTTAGTG TTGAGCAATC CATCAGGGGT GAGGGTTGGC TTTTACAAAT ACACATGTCC GAATGCAGAG  GTCATTATAC GTGATGAGAT GACCAAGATC ATCTCTGGTG TCCCAAGCCT TGCTGGCCCA CTGCTTCGCA TGCACTTCCA TGACTGCTTT GTGAATGGTT GTGATGGTTC TATTCTGCTG  AATAGCACAC CAGGATCACC ATCTGAAAAG GAATCAATAC CGAACCTCAC CCTCCGGGGC TTTGGTACAA TTGACCTTGT CAAGTCTAAG CTAGAGCAAG CCTGCCCTGG GGTGGTCTCC  TGCGCTGATA TCCTAGCTCT TGTAGCAAGG GATGTTGTAC TACTGACCAA AGGGCCTCAT TGGGATGTTC CAACTGGGCG GAGAGACGGA ATGAGATCGG CGAAGGAAGA TGCTTTGAAC  AATCTGCCTC CACCCTTTTT TGATGCCACT CAAAACCTGA ATCAGTTCTT CATTCCTAAG GGCCTTGATG CAAAGGATCA GGTGGTTCTG CTAGGGGGGC ACACCCTTGG GACCTCCCAC  TGCTCTTCGT TCTCGGACCG GCTGTACAAC TTCAGCGGCA CGCACATGGC CGACCCAATG CTGGACAAGC AGTACACCCG GCGCCTGAAA ACCAAGTGCA AGCCCAACGA CACGACGACG  CTGGTGGAGA TGGACCCTGG GAGCTTCAGG ACGTTTGACA CGAGCTACTA CCGTGTCATT GCCAAGGGCA GGGCGCTCTT CACCTCTGAC GAGACGCTCA TGCTCGACCC TTTCACCAGG  GACTACGTGC TGCGGCAGGC GGGCGTCGCC GGCTACCCAG CTGAGTTCTT CGCAGACTTC GCGGCGTCCA TGGTGAAGAT GGGGAACATG CAGGTGCTCA CCGGCGCACA GGGGGAGATC  AGGAAGCACT GCGCCTTTGT GAATAAGATG CACATATTAT AGCTCGGTTT ACGTGATAAT TACTTGCCTT AGTGGTTGGT TTCTGGACAT GTAGAATTAC TGTGGTTGTG TTTAAGTACA  TTGTGTGCAC CATGTCTTCC TTCATCATTT GTATTGTTAT CTTGATGTCT TCAAATAAAT AAACTGTTTG CTTGGCTCAA TGAAATAAAC ATGCATCCCA GAGAACTGGG CTACCATTCC 

Retrieve as FASTA