Entry information : AtPrx03 (At1g05260 / PER3 / Atp7a / Atperox7a / AtPRC / AtperoxP3 / Rarecold-inducibleprotein / RCI3A)
Entry ID 79
Creation 2006-02-02 (Filippo Passardi)
Last sequence changes 2015-06-02 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-09 (Achraf Jemmat)
Peroxidase information: AtPrx03 (At1g05260 / PER3 / Atp7a / Atperox7a / AtPRC / AtperoxP3 / Rarecold-inducibleprotein / RCI3A)
Name (synonym) AtPrx03 (At1g05260 / PER3 / Atp7a / Atperox7a / AtPRC / AtperoxP3 / Rarecold-inducibleprotein / RCI3A)
Class Class III peroxidase    [Orthogroup: Prx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Flowers
Green siliques
Roots
Rosettes
Siliques
Stamen Abscission Zone
Inducers Cold stress
Light growth
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx03
start..stop
S start..stop
AhalPrx58 651 0 1..326 1..326
AlyPrx03 647 0 1..326 1..326
CagraPrx16 644 0 1..326 1..326
CbPrx01 642 0 1..326 1..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1529827..1530039 213 N° 2 1530148..1530336 189 N° 3 1530430..1530592 163 N° 4 1530856..1531271 416
join(1529827..1530039,1530148..1530336,1530430..1530592,1530856..1531271)


exon

Literature and cross-references AtPrx03 (At1g05260 / PER3 / Atp7a / Atperox7a / AtPRC / AtperoxP3 / Rarecold-inducibleprotein / RCI3A)
Literature REFERENCE 1 Llorente,F., Lopez-Cobollo,R.M., Catala,R., Martinez-Zapater,J.M. and Salinas,J. A novel cold-inducible gene from Arabidopsis, RCI3, encodes a peroxidase that constitutes a component for stress tolerance. Plant J. 32 (1), 13-24 (2002)
REFERENCE 2 Kim MJ, Ciani S, Schachtman DP. A peroxidase contributes to ROS production during Arabidopsis root response to potassium deficiency. Mol Plant. 2010 Mar;3(2):420-7.
REFERENCE 3 Cai S, Lashbrook CC. Stamen abscission zone transcriptome profiling reveals new candidates for abscission control: enhanced retention of floral organs in transgenic plants overexpressing Arabidopsis ZINC FINGER PROTEIN2. Plant Physiol. 2008 Mar;146(3):1305-21

Protein ref. UniProtKB:   O23044
DNA ref. Phytozome 11:   Chr1 (1529827..1531271)
mRNA ref. GenBank:   NM_100405.3
Cluster/Prediction ref. Phytozome Gene 11:   19649599 UniGene:   At.23986
Omic ref. AtProteome:   At1g05260 ATTED-II:   At1g05260 e-FP Browser:   At1g05260 ePlant:   At1g05260 Genevestigator:   At1g05260 TAIR:   At1g05260
Protein sequence: AtPrx03 (At1g05260 / PER3 / Atp7a / Atperox7a / AtPRC / AtperoxP3 / Rarecold-inducibleprotein / RCI3A)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (302)
PWM (Da):   %s   34796.59 (32339.2) Transmb domain:   %s   i2-24o
PI (pH):   %s   8.49 (8.58) Peptide Signal:   %s   cut: 25 range:25-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNCLIAIALSVSFFLVGIVGPIQAQLQMNFYANSCPNAEKIVQDFVSNHVSNAPSLAAALIRMHFHDCFVRGCDGSVLINSTSGNAERDATPNLTVRGFGFIDAIKSVLEAQCPGIVSCADIIALASRDAVVFTGGPNWSVPTGRRDGRISNAAEALANIPPPTSNITNLQTLFANQGLDLKDLVLLSGAHTIGVSHCSSFTNRLYNFTGRGGQDPALDSEYAANLKSRKCPSLNDNKTIVEMDPGSRKTFDLSYYQLVLKRRGLFQSDSALTTNPTTLSNINRILTGSVGSFFSEFAKSMEKMGRINVKTGSAGVVRRQCSVANS

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 3 introns), 5 cDNA and 21 ESTs.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGCAGAACCG GCCGACCCGA ACAGAAATCT GCAAATCCAC ATATTTCTAA CATGTTTTGG CCCCGGTCCG AATTGTTTCC GCTTATAAAT TACAGGGAAA ATCCTTTTTC AAGATATTTC  CAAAAGAGTT TAAAATTTAA AGATTTCTTT CATCAAAATC TTCTCTAGCC TCACTTATTT TTCCAGGATG AAAATCTAAA AATATCCTCT CAAGTTTTTT TTTTGTTTGT TTAGAATCCA  CATATATATA TATCAGTTTA TTAGAAGATG CCAACGTTTG ACAGACTTAA AGAAATAAAT TGGCGTGGTA ATCTGACGAA ACGCCACTCC TGATGATAGG AAAATATTTC GAGCAGTTGA  AATGCTCTCG TCCGTTTATG AATAATTCAG TTCTATAGAG TAGTTGTGTG AAATTTTAAT TTGTTCTCCT CCCCTAGTAT AATATAATGT TTTAATATCA TTGCGCATGT TACAAAACAA  AGATTAGGCA TCAAGATATA AGAAACACCA ATTTAGGACA AAACAAAAAT TCCAAAAAAA GAGTATACGT TGTAAAGTTG GACATATATA TTAGTTTTAT GTTCTAGTGA CTATTGTATC  GGTTATGACT TATATTATTA AACTACGTTG TAATTTGAAA TTTTATTTCA CTTAAAAACA TGCATTACAA GATTAATTCG GATAATGATA TAACGGCAAC ACTAATCGTC TATCAGAAAA  CATGACTATA CGTGTCCTAC TGTTCGTACA TATATGTTTA ACAAAAGTAA TTTTACTAGG ATCATTACCA TATGGTATAT CTTAGCATCT GAAATTAGTC TATCTACCAA GTCGCAGTTA  ATCCTATATA CTTCTATTAT ACATTAAAGA ACTTAAAAAA AAAAGAAGAT CTTAAGAATA TAAAACAAGG TTAATAATCT TGGAATACTC TCTTGCTCAT TAGCAGTTGT TCTTTTGCGG  TTCTTTTAGT TGTACTACTG CGGATTAGGT CGAGTACGTA TTGTAGTTTT GGAATTAAAA AAAATATCAC TCTCGAAACG AGTTTTTTTT TTTTTTTTGG ATGGGAAGAT GTCGGCAAAA  ACGAGTTGTT CTTCAGTGAA AAATCAAAGT ACGTTATGTC TTGAGGTGAT TGATCATCCA AAAATTTAGA GTATTCAAGA TTACCAATAT TCTAGTACTC GATCGCGACT AAAATAAATG  AATCCAAAAT AAGATTCCAT ATAATCTCAA TTATGTTATA AAAAAAATTA CAGTTGTTGA TTATGACATC AGAACACTCG ATACTTTTAA TTACATTCAG CTAATCTTTC TATGTTACTA  ACTCACTAAA ATCTACTGTT GGCTTGACTT TTTGTATCGA TGATTATGAC ATCATAACGC TCAACACAAT CTATTGCGTT TTGGTATATA AAAAAACAAA AATCGTTGAT TATGACATCA  TAACGGTCAT TAAAATCAAG ACTTTCTATG TTACTAACTT ACTATAGCTT GATTTATGGA CCAAACATTC ACCATCTTTT ACCATATCTA ATACTTTTGA TATTTTTAGT ATCAGAGTAT  ATTTTTGATA TTTTGGTTAA TATATATTAG AAAACAAATT CGCTACGTGT TTTAGAACAT ACAAATTACA AATTAGTTTT ACAAATTACA GGAAAATAAA TATAAGTGGA AAGACGTAAA  CTTTAATTAA CTTTTTTTTA TAAAAAAACT CTTCCAAATT GCCTCATTGA AGTGTAACAT TATCTCTTCA TTAGTAAGAG TATTAAAAAA CCATTTTGTA ATTATGAATA AAAATTTCTC  AAATTTTTAT TGTGGCGCTG ATTATGAGCC AGAAAAATAA AGTAGAAAAA GAGCACATGT TAGTTAGCTT AGATGGACCC ACTTCTACTA CCAAACATGC AAACTCTTCT ATATAAACCT 
ATGTTAACGT CTCAATACAT CACACAACAT AATCCTCCCA AACAGAGAGA GTCTCAAAAA TTAAACCAAC AAATTTAAAG 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGGGTGGAAA TGTAAAAGAT TTGGGAGCTT GTGGGGGTAG TTGTGATAAT AATTAATAAG GATGATTGTG AATTTATGAT GTGGCCTTTT GGGATTTGTG TGTATGGATT TTGTTACAGA  CTTCGTCAAT AAAGAAATAA AAAGATTTTA CTGCTTTTTT TTTAACATAT TTGGCTTGTC GTGTATGAAT CATGACATTT TAGTTGGTTT GAGTAGTAAC ACTGTCATTT TGTAGATAGA  GTTATATGCA ATCTGGATAG AGGATCCAGA TTGTTTAATT GCTTTTAGTG GCAGTTTTGA AACGAGTATT TTCACCTACC CCTAGCTCAA ACTCGGATTA CTTCCAACTA TCTAAAGAAA  ATACCGAAAG ACCAAAAAAA AAGCTTTATT ATTTTCATCA ATAAACGTAC AGAAGTGAAA AAAAAGAAAA AAAAGAAAGA GTAAACGAGT GTAAAAGTTA TTTGAGTTTG TATCATTCCT  TCGTATGGCT CAGGAGAAAG AAGAGAAAAA CTCTGCCCCA ATTACAATCC TTTTTCACTT TCTTCTTGAA AGAAGTATAC CCGAAACTAT AGCTGTCCCT GCAACTGCAA CTGCCACTGA  TGATATTATT CTCTTTAACG TAAACACTGA CTTGTCGCTT GGTATCTCCA TTAGATCATT CATCTGCAAT TTCCGTGAAA ACGAACATAA ATCACAATCC GAAACAAAAA TAAGCTCCTT  CATTCAGATA TTGAAACGAC AACAAACCGT AATAGGTTGC TTCCAATTCT TCTTGATTCC ATTAATATGT CCTTTTCCGA TAACTGCTAC AACCGAACTA TGGTCACTTG CAACTCTCAG  CAAAGAGGAT GCCATGTACC TGCGCATTTC ATTTATCAGG ATGTGAAGTC GATGATAATT TGTTAATTCT TCTCTATATT TGCTACTACC AGCATTTCTA TTTTTAGTTT ACGAATCTGA 
TAAACTACAT AGAGGGAATA GAGAATACTA ACTGGTCTCG 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATTGCTTGATAGCTATAGCTCTTTCAGTCTCTTTCTTTCTTGTGGGAATTGTTGGACCGATCCAAGCTCAATTGCAGATGAATTTCTATGCCAATTCTTGTCCTAATGCTGAAAAG
ATTGTTCAAGATTTTGTTTCAAACCACGTTTCTAATGCTCCTTCTCTTGCTGCTGCTCTCATTAGAATGCATTTCCATGACTGTTTTGTCCGA
GTAAACTCTTCTTTTCCCTCTTTTTTT
TTCTTTTTTTCTTTATATAGTGGAACATTCTGAATAACTACGAAACTAATTAATGACGGATATATATACATGTACATGTAGGGTTGTGATGGATCAGTGCTTATAAACTCAACGTCAGGA
AACGCAGAGAGAGACGCGACTCCTAACCTAACGGTTCGAGGGTTTGGCTTCATCGACGCAATTAAATCTGTGCTTGAAGCTCAATGCCCTGGAATTGTCTCTTGCGCTGATATTATCGCT
CTAGCTTCTCGCGACGCTGTCGTTTTCACC
GTAAGCATCATATTCATCACATAACATTACTCTAAATTAAAAAATCTTAATTAGTATTTCTCATCATAAATTCTGACCTTTGGTATGTTG
TAGGGAGGACCGAATTGGAGTGTACCGACCGGAAGAAGAGACGGGAGGATATCAAACGCAGCGGAGGCATTAGCCAACATTCCTCCTCCAACCAGTAATATCACCAATCTTCAGACACTC
TTTGCAAACCAAGGACTTGATCTTAAGGACCTCGTTTTACTATCCG
GTAAAGCCTAAACTCATTCCACACTCTAAGAATAAAAAATTATTGAGTGTTTTAGAAGAAAATATTTGCGTTTA
AGATTTATAAAACATGTGTTAATCATACACACAAAAAACGACTATTATGATGGTTTCACAATAACCGAAAAGTAATACTTATTATGATTTCAATAAAGAAAATTAGAAAGTACTGTTTTT
ATGATATAGAGAACATTTCAACCTAGAGTTTCAAGATATATTTACAAGAAATATATGTGTTATAAACAGGGGCTCACACTATTGGTGTATCTCACTGCTCGTCTTTCACAAACCGTCTCT
ACAATTTTACGGGTCGTGGAGGCCAAGATCCGGCTTTGGACAGCGAGTACGCAGCCAATCTCAAGTCTAGAAAATGTCCTAGCCTCAACGATAACAAGACCATCGTAGAGATGGATCCAG
GGAGCCGCAAAACATTTGATCTAAGTTATTACCAGCTCGTACTCAAGCGTAGAGGTCTGTTTCAATCAGACTCTGCTCTCACCACTAACCCCACAACACTTTCAAACATAAACCGGATCT
TGACGGGTTCGGTGGGGAGTTTCTTCTCTGAGTTTGCCAAGTCAATGGAGAAAATGGGTCGGATCAATGTCAAGACTGGTTCAGCTGGAGTGGTTAGGAGGCAATGTTCCGTTGCAAATA
GTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATTGCTTGATAGCTATAGCTCTTTCAGTCTCTTTCTTTCTTGTGGGAATTGTTGGACCGATCCAAGCTCAATTGCAGATGAATTTCTATGCCAATTCTTGTCCTAATGCTGAAAAG
ATTGTTCAAGATTTTGTTTCAAACCACGTTTCTAATGCTCCTTCTCTTGCTGCTGCTCTCATTAGAATGCATTTCCATGACTGTTTTGTCCGA
GGTTGTGATGGATCAGTGCTTATAAAC
TCAACGTCAGGAAACGCAGAGAGAGACGCGACTCCTAACCTAACGGTTCGAGGGTTTGGCTTCATCGACGCAATTAAATCTGTGCTTGAAGCTCAATGCCCTGGAATTGTCTCTTGCGCT
GATATTATCGCTCTAGCTTCTCGCGACGCTGTCGTTTTCACC
GGAGGACCGAATTGGAGTGTACCGACCGGAAGAAGAGACGGGAGGATATCAAACGCAGCGGAGGCATTAGCCAACATT
CCTCCTCCAACCAGTAATATCACCAATCTTCAGACACTCTTTGCAAACCAAGGACTTGATCTTAAGGACCTCGTTTTACTATCCG
GGGCTCACACTATTGGTGTATCTCACTGCTCGTCT
TTCACAAACCGTCTCTACAATTTTACGGGTCGTGGAGGCCAAGATCCGGCTTTGGACAGCGAGTACGCAGCCAATCTCAAGTCTAGAAAATGTCCTAGCCTCAACGATAACAAGACCATC
GTAGAGATGGATCCAGGGAGCCGCAAAACATTTGATCTAAGTTATTACCAGCTCGTACTCAAGCGTAGAGGTCTGTTTCAATCAGACTCTGCTCTCACCACTAACCCCACAACACTTTCA
AACATAAACCGGATCTTGACGGGTTCGGTGGGGAGTTTCTTCTCTGAGTTTGCCAAGTCAATGGAGAAAATGGGTCGGATCAATGTCAAGACTGGTTCAGCTGGAGTGGTTAGGAGGCAA
TGTTCCGTTGCAAATAGTTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CACACAACAT AATCCTCCCA AACAGAGAGA GTCTCAAAAA TTAAACCAAC AAATTTAAAG ATGAATTGCT TGATAGCTAT AGCTCTTTCA GTCTCTTTCT TTCTTGTGGG AATTGTTGGA  CCGATCCAAG CTCAATTGCA GATGAATTTC TATGCCAATT CTTGTCCTAA TGCTGAAAAG ATTGTTCAAG ATTTTGTTTC AAACCACGTT TCTAATGCTC CTTCTCTTGC TGCTGCTCTC  ATTAGAATGC ATTTCCATGA CTGTTTTGTC CGAGGTTGTG ATGGATCAGT GCTTATAAAC TCAACGTCAG GAAACGCAGA GAGAGACGCG ACTCCTAACC TAACGGTTCG AGGGTTTGGC  TTCATCGACG CAATTAAATC TGTGCTTGAA GCTCAATGCC CTGGAATTGT CTCTTGCGCT GATATTATCG CTCTAGCTTC TCGCGACGCT GTCGTTTTCA CCGGAGGACC GAATTGGAGT  GTACCGACCG GAAGAAGAGA CGGGAGGATA TCAAACGCAG CGGAGGCATT AGCCAACATT CCTCCTCCAA CCAGTAATAT CACCAATCTT CAGACACTCT TTGCAAACCA AGGACTTGAT  CTTAAGGACC TCGTTTTACT ATCCGGGGCT CACACTATTG GTGTATCTCA CTGCTCGTCT TTCACAAACC GTCTCTACAA TTTTACGGGT CGTGGAGGCC AAGATCCGGC TTTGGACAGC  GAGTACGCAG CCAATCTCAA GTCTAGAAAA TGTCCTAGCC TCAACGATAA CAAGACCATC GTAGAGATGG ATCCAGGGAG CCGCAAAACA TTTGATCTAA GTTATTACCA GCTCGTACTC  AAGCGTAGAG GTCTGTTTCA ATCAGACTCT GCTCTCACCA CTAACCCCAC AACACTTTCA AACATAAACC GGATCTTGAC GGGTTCGGTG GGGAGTTTCT TCTCTGAGTT TGCCAAGTCA  ATGGAGAAAA TGGGTCGGAT CAATGTCAAG ACTGGTTCAG CTGGAGTGGT TAGGAGGCAA TGTTCCGTTG CAAATAGTTA AGGGGTGGAA ATGTAAAAGA TTTGGGAGCT TGTGGGGGTA  GTTGTGATAA TAATTAATAA GGATGATTGT GAATTTATGA TGTGGCCTTT TGGGATTTGT GTGTATGGAT TTTGTTACAG ACTTCGTCAA TAAAGAAATA AAAAGATTTT ACTGCTTTTT 
TTTTAACAT 

Retrieve as FASTA