Entry information : BdiPrx135 (Bradi5g27130)
Entry ID 7900
Creation 2011-01-17 (Toky Ramarohetra)
Last sequence changes 2011-01-17 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx135 (Bradi5g27130)
Name (synonym) BdiPrx135 (Bradi5g27130)
Class Class III peroxidase    [Orthogroup: Prx060]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx135
start..stop
S start..stop
SiPrx88 492 1e-176 1..341 1..349
HvPrx07 467 5e-167 30..342 26..341
ZmPrx24 468 6e-167 25..341 32..356
TaPrx107 466 2e-166 30..342 26..341
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 28037901..28038311 411 N° 2 28037155..28037772 618  
complement(join(28037155..28037772,28037901..28038311))


exon

Literature and cross-references BdiPrx135 (Bradi5g27130)
DNA ref. Phytozome 12:   Bd5 (28038311..28037155)
EST ref. GenBank:   DV487223.1 [3' end]   DV486525.1 [Fragment]
Protein sequence: BdiPrx135 (Bradi5g27130)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   342 (319)
PWM (Da):   %s   36318.41 (34129.2) Transmb domain:   %s   i7-29o
PI (pH):   %s   6.23 (6.03) Peptide Signal:   %s   cut: 24 range:24-342
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSRAAVVVFLLALSSSLGASAAPVAPGLSWGFHDTSCPDLDHIVKYHVGEAFRRDVGIAPALVRILFHDCFPQGCDASVLLNGTGSELLEVPNQTLRPTALKLIDDIRAAVHRFCGPVVSCADITALATRDALVAAGGPTYEIPLGRRDGLAPASKALVGTLPAPFFDVPTLIKSFKDRNLTTADLVSLSGAHTIGHSHCPSFNDRFPPSADPTIDPDFSKKLQAKCAADVPSGTVTQVNDVRTPDVFDNKYYFDLIARQGLFKSDQGLIDHADTKRMATRFALNQGAFFEQFAASMVKMSNMDVLTGTQGEIRLISCSVPNNRVSGVQTADDEGLVAEM*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, intron 2), 2 ESTs. Cultivar="Bd21".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCGTCTAGAGCGGCCGTCGTCGTCTTCCTCCTGGCGCTCTCCTCCTCCCTCGGCGCCAGCGCCGCTCCGGTGGCCCCCGGGCTGTCGTGGGGGTTCCACGACACGTCGTGCCCG
GACCTGGACCACATCGTGAAGTACCACGTCGGCGAGGCCTTCCGGCGCGACGTGGGCATCGCGCCGGCGCTCGTCCGCATCCTCTTCCATGACTGCTTCCCGCAGGGCTGCGACGCCTCC
GTGCTCCTCAACGGGACCGGCAGCGAGCTCCTCGAGGTCCCCAACCAGACGCTCCGCCCCACGGCGCTCAAGCTCATCGACGACATCCGTGCCGCCGTCCACCGCTTCTGCGGCCCCGTC
GTCTCCTGCGCCGACATCACCGCCCTCGCCACCCGTGACGCCCTCGTCGCC
GTAAGCACACATGCATTACAACATAATGCGTGCACAGTTTGCAAGTTTGCACGGAACGAAGGTTTGCAT
TGGATACGTCTTTTAAACATATAAGACGTAACTAACCCGTATATAATTTGTCGTTCTAGGCTGGCGGGCCGACATACGAGATACCGCTAGGCCGGCGTGACGGACTAGCCCCAGCGTCCA
AGGCCCTCGTCGGAACCCTACCGGCCCCCTTCTTCGACGTGCCGACCCTCATCAAATCCTTCAAGGACCGCAACCTCACGACCGCCGACCTCGTCTCCCTCTCCGGCGCGCACACCATCG
GCCACTCCCACTGCCCGTCCTTCAACGACCGCTTCCCTCCCTCCGCGGACCCGACGATCGACCCGGACTTCTCCAAGAAACTCCAAGCCAAGTGCGCCGCCGACGTCCCCTCCGGCACCG
TAACGCAGGTCAACGACGTGCGCACGCCGGACGTGTTCGACAACAAGTACTACTTCGACCTCATCGCCAGGCAAGGGCTGTTCAAGTCGGACCAGGGCCTCATCGACCATGCCGACACCA
AGCGCATGGCCACACGGTTCGCGCTCAACCAGGGCGCCTTCTTCGAGCAGTTTGCGGCGTCCATGGTGAAGATGAGCAATATGGACGTGCTTACGGGCACCCAGGGCGAGATCAGGCTCA
TCAGTTGCTCTGTGCCGAACAACCGTGTCTCTGGTGTCCAGACTGCCGACGATGAGGGCCTCGTTGCTGAGATGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCGTCTAGAGCGGCCGTCGTCGTCTTCCTCCTGGCGCTCTCCTCCTCCCTCGGCGCCAGCGCCGCTCCGGTGGCCCCCGGGCTGTCGTGGGGGTTCCACGACACGTCGTGCCCG
GACCTGGACCACATCGTGAAGTACCACGTCGGCGAGGCCTTCCGGCGCGACGTGGGCATCGCGCCGGCGCTCGTCCGCATCCTCTTCCATGACTGCTTCCCGCAGGGCTGCGACGCCTCC
GTGCTCCTCAACGGGACCGGCAGCGAGCTCCTCGAGGTCCCCAACCAGACGCTCCGCCCCACGGCGCTCAAGCTCATCGACGACATCCGTGCCGCCGTCCACCGCTTCTGCGGCCCCGTC
GTCTCCTGCGCCGACATCACCGCCCTCGCCACCCGTGACGCCCTCGTCGCC
GCTGGCGGGCCGACATACGAGATACCGCTAGGCCGGCGTGACGGACTAGCCCCAGCGTCCAAGGCCCTC
GTCGGAACCCTACCGGCCCCCTTCTTCGACGTGCCGACCCTCATCAAATCCTTCAAGGACCGCAACCTCACGACCGCCGACCTCGTCTCCCTCTCCGGCGCGCACACCATCGGCCACTCC
CACTGCCCGTCCTTCAACGACCGCTTCCCTCCCTCCGCGGACCCGACGATCGACCCGGACTTCTCCAAGAAACTCCAAGCCAAGTGCGCCGCCGACGTCCCCTCCGGCACCGTAACGCAG
GTCAACGACGTGCGCACGCCGGACGTGTTCGACAACAAGTACTACTTCGACCTCATCGCCAGGCAAGGGCTGTTCAAGTCGGACCAGGGCCTCATCGACCATGCCGACACCAAGCGCATG
GCCACACGGTTCGCGCTCAACCAGGGCGCCTTCTTCGAGCAGTTTGCGGCGTCCATGGTGAAGATGAGCAATATGGACGTGCTTACGGGCACCCAGGGCGAGATCAGGCTCATCAGTTGC
TCTGTGCCGAACAACCGTGTCTCTGGTGTCCAGACTGCCGACGATGAGGGCCTCGTTGCTGAGATGTAG

Retrieve as FASTA