Entry information : BdiPrx136 (Bradi5g27150)
Entry ID 7901
Creation 2011-01-17 (Toky Ramarohetra)
Last sequence changes 2011-01-17 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx136 (Bradi5g27150)
Name (synonym) BdiPrx136 (Bradi5g27150)
Class Class III peroxidase    [Orthogroup: Prx161]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx136
start..stop
S start..stop
BdiPrx69 360 2e-124 6..332 10..337
BdiPrx138 327 7e-112 1..338 1..322
OsPrx59 313 4e-106 1..329 1..332
BdiPrx137 302 9e-102 9..320 3..310
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 28044979..28045236 258 N° 2 28043986..28044780 795  
complement(join(28043986..28044780,28044979..28045236))


exon

Literature and cross-references BdiPrx136 (Bradi5g27150)
DNA ref. Phytozome 12:   Bd5 (28045236..28043986)
Protein sequence: BdiPrx136 (Bradi5g27150)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   350 (324)
PWM (Da):   %s   37627.72 (35060.3) Transmb domain:   %s   i9-31o
PI (pH):   %s   6.42 (6.04) Peptide Signal:   %s   cut: 27 range:27-350
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFSRAAKLGMVVVAVLLLSAPAALSLPSLISMPNNDAGGLSYDFHDASCPNLDQMVHDAVKKAKEADVGVVAGLLRLSFHDCFPQGCDASILLLNKFWGELNMPQNHGIRRSAVHLIEDIRKAVHEACGATVSCADILNLATRQAVMQSGVPGYEVPLGRLDSPWPAALKKVQELPGPGFNATELKESLASRGLDTTDLVALSGAHTIGRASCRSFSDRFHENNDGFVRRLRDNCTGNADRLQELDVTTPDTFDNKYYSNLVNGEGVLSSDMALTRDAETGMLVRNFAGNQGWFFSQFGTSMRKVAHLPGAQEANGQIRRYSCFWNNAWGPAGPPAAYLAGEELLKASV*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, intron 1), no EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCAGCAGGGCAGCAAAGCTGGGCATGGTCGTCGTTGCCGTGCTGCTGCTCTCTGCCCCGGCAGCCTTGTCCTTGCCGTCGTTGATCTCCATGCCCAACAACGACGCCGGGGGT
CTGTCCTATGACTTCCACGACGCGTCGTGCCCGAACCTGGATCAAATGGTGCACGATGCCGTGAAGAAAGCAAAGGAGGCAGATGTCGGTGTCGTTGCCGGCCTCCTCCGCTTGTCCTTC
CACGACTGCTTCCCTCAG
GTATACATACATTCTCTATGTAGCTAGTCCAAACACTTATTAACGAAGAGTTTCACGTACCGAACCAGCTCACCCAAAAGCTCGATCAAGCGGATGGAGAAA
TGAGAACAATCAACTTATACTTCAACAATTAAGGCATGCGTCGTCAAATTAAATACCTAACCATGCATATATATATATTACATATATAAACTACAGGGCTGCGACGCGTCGATTCTACTG
TTGAACAAGTTCTGGGGCGAGCTGAACATGCCTCAGAACCACGGGATCCGGCGGAGCGCGGTGCATCTCATCGAGGACATCCGCAAGGCGGTGCACGAAGCCTGCGGCGCCACCGTCTCC
TGCGCCGACATCCTCAACCTGGCCACCCGGCAGGCCGTGATGCAGTCCGGGGTGCCAGGGTACGAGGTGCCGCTGGGCCGCCTCGACAGCCCCTGGCCGGCCGCGCTCAAAAAGGTCCAG
GAACTCCCGGGGCCCGGCTTCAACGCCACCGAGCTCAAGGAATCCCTGGCCAGCCGCGGCCTCGACACGACCGACCTCGTGGCGCTCTCCGGCGCGCACACCATCGGCAGGGCGAGCTGC
CGGAGCTTCAGCGACCGGTTCCATGAGAACAACGACGGCTTCGTCCGGAGGCTCCGGGACAACTGCACCGGCAATGCCGACCGGCTGCAGGAGCTCGATGTGACCACCCCGGACACCTTC
GACAACAAGTACTATAGCAACCTGGTGAACGGGGAAGGAGTGCTCAGCTCCGACATGGCGCTCACCCGTGACGCCGAGACCGGCATGTTGGTCCGCAACTTCGCCGGGAACCAAGGGTGG
TTCTTCAGCCAGTTTGGGACGTCCATGAGGAAGGTGGCGCATCTGCCGGGAGCCCAGGAAGCCAACGGCCAGATCCGGAGGTACAGCTGCTTCTGGAACAACGCGTGGGGGCCGGCCGGG
CCGCCTGCCGCCTACCTTGCCGGCGAGGAGCTCCTCAAGGCCTCCGTTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCAGCAGGGCAGCAAAGCTGGGCATGGTCGTCGTTGCCGTGCTGCTGCTCTCTGCCCCGGCAGCCTTGTCCTTGCCGTCGTTGATCTCCATGCCCAACAACGACGCCGGGGGT
CTGTCCTATGACTTCCACGACGCGTCGTGCCCGAACCTGGATCAAATGGTGCACGATGCCGTGAAGAAAGCAAAGGAGGCAGATGTCGGTGTCGTTGCCGGCCTCCTCCGCTTGTCCTTC
CACGACTGCTTCCCTCAG
GGCTGCGACGCGTCGATTCTACTGTTGAACAAGTTCTGGGGCGAGCTGAACATGCCTCAGAACCACGGGATCCGGCGGAGCGCGGTGCATCTCATCGAGGAC
ATCCGCAAGGCGGTGCACGAAGCCTGCGGCGCCACCGTCTCCTGCGCCGACATCCTCAACCTGGCCACCCGGCAGGCCGTGATGCAGTCCGGGGTGCCAGGGTACGAGGTGCCGCTGGGC
CGCCTCGACAGCCCCTGGCCGGCCGCGCTCAAAAAGGTCCAGGAACTCCCGGGGCCCGGCTTCAACGCCACCGAGCTCAAGGAATCCCTGGCCAGCCGCGGCCTCGACACGACCGACCTC
GTGGCGCTCTCCGGCGCGCACACCATCGGCAGGGCGAGCTGCCGGAGCTTCAGCGACCGGTTCCATGAGAACAACGACGGCTTCGTCCGGAGGCTCCGGGACAACTGCACCGGCAATGCC
GACCGGCTGCAGGAGCTCGATGTGACCACCCCGGACACCTTCGACAACAAGTACTATAGCAACCTGGTGAACGGGGAAGGAGTGCTCAGCTCCGACATGGCGCTCACCCGTGACGCCGAG
ACCGGCATGTTGGTCCGCAACTTCGCCGGGAACCAAGGGTGGTTCTTCAGCCAGTTTGGGACGTCCATGAGGAAGGTGGCGCATCTGCCGGGAGCCCAGGAAGCCAACGGCCAGATCCGG
AGGTACAGCTGCTTCTGGAACAACGCGTGGGGGCCGGCCGGGCCGCCTGCCGCCTACCTTGCCGGCGAGGAGCTCCTCAAGGCCTCCGTTTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCA GCAGGGCAGC AAAGCTGGGC ATGGTCGTCG TTGCCGTGCT GCTGCTCTCT GCCCCGGCAG CCTTGTCCTT GCCGTCGTTG ATCTCCATGC CCAACAACGA CGCCGGGGGT  CTGTCCTATG ACTTCCACGA CGCGTCGTGC CCGAACCTGG ATCAAATGGT GCACGATGCC GTGAAGAAAG CAAAGGAGGC AGATGTCGGT GTCGTTGCCG GCCTCCTCCG CTTGTCCTTC  CACGACTGCT TCCCTCAGGG CTGCGACGCG TCGATTCTAC TGTTGAACAA GTTCTGGGGC GAGCTGAACA TGCCTCAGAA CCACGGGATC CGGCGGAGCG CGGTGCATCT CATCGAGGAC  ATCCGCAAGG CGGTGCACGA AGCCTGCGGC GCCACCGTCT CCTGCGCCGA CATCCTCAAC CTGGCCACCC GGCAGGCCGT GATGCAGTCC GGGGTGCCAG GGTACGAGGT GCCGCTGGGC  CGCCTCGACA GCCCCTGGCC GGCCGCGCTC AAAAAGGTCC AGGAACTCCC GGGGCCCGGC TTCAACGCCA CCGAGCTCAA GGAATCCCTG GCCAGCCGCG GCCTCGACAC GACCGACCTC  GTGGCGCTCT CCGGCGCGCA CACCATCGGC AGGGCGAGCT GCCGGAGCTT CAGCGACCGG TTCCATGAGA ACAACGACGG CTTCGTCCGG AGGCTCCGGG ACAACTGCAC CGGCAATGCC  GACCGGCTGC AGGAGCTCGA TGTGACCACC CCGGACACCT TCGACAACAA GTACTATAGC AACCTGGTGA ACGGGGAAGG AGTGCTCAGC TCCGACATGG CGCTCACCCG TGACGCCGAG  ACCGGCATGT TGGTCCGCAA CTTCGCCGGG AACCAAGGGT GGTTCTTCAG CCAGTTTGGG ACGTCCATGA GGAAGGTGGC GCATCTGCCG GGAGCCCAGG AAGCCAACGG CCAGATCCGG  AGGTACAGCT GCTTCTGGAA CAACGCGTGG GGGCCGGCCG GGCCGCCTGC CGCCTACCTT GCCGGCGAGG AGCTCCTCAA GGCCTCCGTT TGATGTCGGA TCATATCACC CACATTAATA  ACATGCACCA TGCGTGCGTT GACAACGTAC CCTAGCTACC CGGATGTTGT CAAAGGCACG TTTCTTTCTT TTTCTTTGCA CACGCCATGT AATAAGAGCT AGCTAGCTAG GGCCAAGCTA  TGACCCTTGT GGGCTGTTTG CTTGATAGTA GTGTATGCCA GCCGTGTGCG GGCCTAGTTT GTGTGTCACG TTTCAGCAAC TATATGTACT GCCTTACAGT GCAATAATAG AGTTAAAGGG 
TTGCTATA 

Retrieve as FASTA