Entry information : BdiAPx01 (Bradi1g16510)
Entry ID 7906
Creation 2011-01-17 (Toky Ramarohetra)
Last sequence changes 2011-01-17 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-01-19 (Toky Ramarohetra (Scipio))
Peroxidase information: BdiAPx01 (Bradi1g16510)
Name (synonym) BdiAPx01 (Bradi1g16510)
Class Ascorbate peroxidase    [Orthogroup: APx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiAPx01
start..stop
S start..stop
HvAPx03 503 0 1..256 1..256
TaAPx04 499 0 1..256 1..254
ZmAPx02_B73 471 3e-171 4..248 3..247
SbAPx02 470 8e-171 4..248 3..247
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 13366543..13366664 122 N° 2 13366740..13366914 175 N° 3 13367004..13367069 66 N° 4 13368189..13368237 49
N° 5 13368577..13368662 86 N° 6 13368754..13368833 80 N° 7 13368963..13369065 103 N° 8 13369181..13369239 59
N° 9 13369337..13369367 31  
join(13366543..13366664,13366740..13366914,13367004..13367069,13368189..13368237 ,13368577..13368662,13368754..13368833,13368963..13369065,13369181..13369239,133 69337..13369367)


exon

Literature and cross-references BdiAPx01 (Bradi1g16510)
DNA ref. Phytozome 12:   Bd1 (13366543..13369367)
EST ref. GenBank:   DV480596.1 [5' end]   DV475156.1 [3' end]
Protein sequence: BdiAPx01 (Bradi1g16510)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   256
PWM (Da):   %s   27612.88  
PI (pH):   %s   5.15
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAKCYPTVTDEYQTAVAKAKRKLRGLIAEKNCAPLMLRLAWHSAGTFDVATKTGGPFGTIKCPAELAHGANAGLDIAVRLLEPIKDQFPILSYADFYLAGVVAVEVTGGPEVPFHPGRQDKPEPPPEGRLPDATQGSDHLRQVFSTQMGLSDQDIVALSGGHTGRCHKERSGFEGAWTANPLIFDNSYFKELLSGEKEGLLQLPTDKTLLSDPAFRPLVDKYADEDAFFADYAEAHLKLSELGFGGYFEGCC

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 8 introns), 10 ESTs. Cultivar="Bd21-0".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCCAAGTGCTACCCAACAGTCACCGATGAGTACCAGACGGCCGTCGCCAAGGCCAAGCGCAAGCTCCGCGGCCTCATCGCCGAGAAGAACTGCGCCCCTCTCATGCTGCGCCTC
GC
GTGCGTATATCTTCTCTCTTCTCTTCCGACCTCGCTAGACTAGAGTTGCTAGATCTGACCATTCTCTCTCTGCAGGTGGCACTCGGCGGGGACCTTCGACGTCGCCACCAAGACCGGC
GGCCCCTTCGGAACCATCAAGTGCCCCGCGGAGCTCGCGCACGGCGCCAACGCGGGCCTCGACATCGCCGTCAGGCTACTCGAGCCCATCAAGGACCAATTCCCCATCCTCTCCTACGCC
GACTTCTACCAG
GTCAGCGATCCCATCCTCTCCTACGCCGAGATCTGGAATTTGTTCTACTTTTCTTAAATTTATTTTTTGCCTTTTATGCTCTGTGGCAGCTCGCTGGAGTCGTGGCCG
TCGAGGTGACCGGCGGACCTGAGGTTCCATTCCACCCGGGCAGACAG
GTGACCATACTTTTCAATTTCCCTGCCCAACTGCGATTTCTCTACAGGGCCCGCTGTTTCGTTACTTTTACCT
GCCGCGACCTAAGATAGTAGTGCCAACCATTTCTCTATCGTGTATCATCATCATCATCATCATCATCATCATTATCTTTATCTTTAGAAACCATTTGGCATTGGTAGTTGGCCCAGAAGA
AATTATTTTAGGATGTTCTGATGGATAGATGCAAGACAATTAGTATGTTGTGATGGATTGGTGCAAGATGATTGTTGTCGCATCTGTCGATGTGCGATTATTTGTTATTTTATACATGAT
GCCAAGTTTGTTGCCATCTTCTGTCTATTTTCTTGTTTCTCAGGATCAGATTTATCTTCTTTTGTTCCATTCCACATTTGACTCTGATCTCTTAAGCTATAACTATCACAATAAATAAGA
TGGTATCTCATAAAGTTTCTGGTACACATGTGTTAGGTGTGGTAATGAGAGTTTAGAGGTGTTGTTGTTCTCTTCAAGTAAATCTGATTATTATGTCCTACTGGGGGTATAAATCATGTA
TGGCATGCATATCCTAACAACTACATTACATAGGAATATACCTTCTTATTGATGTCTTATGGTTTAGGTAAACAGCGTCAGTTTAGGGCTGGAAGTTCGCTTTCCCTTCACATTATATCT
TGCGTTTGTTGATCTATCTTCTGTGCACATTGTTTCTTATGCAACATTGTATTCATTTCTTTAGTTGCTCTGCACCCAAGTGTCACGCGATAATTGTGCTCCAACTTGCCAATTGATCCC
TATTTCTTCTTCTGTATAGATGTGAGAACATTGTTTATCTCTTCATATCCTTTGGTTAAACTATATATTTCTGTAGGTCACTCTTCTTTCTAGTAAGTAGCTACTGGTTGGGCATAATAA
TCAATATGATAGCTACGTGAAGGAACATGTACTGTTGTGTGTGATTGTGATTGAGTTAGAATCTGCATGTCTTCGTATTCTCATGATCCTTTCTAAAATATATTTTCATGCAAAATGACT
CAGTAGCACCAGTTTTCTTTCCCTGTGTGGGTGTATCCATGCAGTGTTAGTCATGGAGTTTTACGATGTGTTGTCTTTGTTTGTAGGACAAGCCTGAGCCTCCTCCAGAAGGCCGCCTTC
CTGATGCCACCCAAG
GTACAACCGTGAAAACATGTCTTATTGCTTTGTTAATTTTGGTACTGTACCATTTATGCAAGGGTGGAATGCTTTTAAGAATGTTATAAAATATCATCGTTTAGC
ATTTCGCAGTGTTACGCAGTGGTGACATTTCTACGTTATGGTGGGCATAGTTTATTACAGAACACTCTCTACTTTCTTGAGGCTAATTATTTCATTTCTTTATATTGCAAATCCAATACC
AAAATGTTTGGCCGCTTCTGGGAGCTTTGTGTAACCTCCAAAATTCTAAAATTTTCCGAGCAGTATCTCTGAATATATGGCTAGGCTGACATGTTGATATTACTATTGTGTCAGGCTCTG
ACCACCTCAGGCAGGTATTTTCCACTCAGATGGGTTTGAGCGACCAGGACATTGTTGCGCTTTCTGGTGGTCACACCCTG
GTTGGTCCAATTGTGCAATTAGCATATTTGTGTCATGCTT
GTTTGTAGGCTTGAAGAGTCCTGCTTATGCAGCTTCAATTATCATGTGCAGGGAAGGTGCCACAAGGAAAGATCTGGCTTTGAGGGAGCGTGGACTGCCAACCCTTTGATCTTTGACAAC
TCGTACTTCAA
GTAAGAGTGATATCTGCTTTTTGAAAGCATGCGGCCTGTTTATTTGTATAAGAGTCCAAGCTGCCTCCGTGTTTTTTCCTGTTCATGATGTTCTTTTTTCCTCAACCGA
AAGTTTATATATCTTGACAGGGAGCTCCTGAGTGGCGAGAAGGAAGGCCTTCTTCAGTTGCCGACTGACAAAACCCTCCTGTCCGACCCGGCCTTCCGCCCACTCGTGGATAAATATGCT
GCG
GTACACCCTTGATCCTGGTTTCTTGTGTAGTTCTAGTTCACTGTTGGGTGGCTACCCCACCAATCCAGTACTGTATAAGCTTATCTGAGACATTTGATGCTGGTTAATGTTGCAGGA
TGAGGATGCTTTCTTTGCTGACTATGCTGAGGCACACCTGAAGCTCTCTGAGTTGGG
GTAAGTAACACGATCATCGTTCTCGTTGATGCATCATTGAAATGACTTGCTAGCGCAACATTG
TCAGAAAGTAGACCCCCTTGTTGATTGTTTCCAGATTTGGCGGGTACTTCGAAGGTTGTTGCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCCAAGTGCTACCCAACAGTCACCGATGAGTACCAGACGGCCGTCGCCAAGGCCAAGCGCAAGCTCCGCGGCCTCATCGCCGAGAAGAACTGCGCCCCTCTCATGCTGCGCCTC
GC
GTGGCACTCGGCGGGGACCTTCGACGTCGCCACCAAGACCGGCGGCCCCTTCGGAACCATCAAGTGCCCCGCGGAGCTCGCGCACGGCGCCAACGCGGGCCTCGACATCGCCGTCAGG
CTACTCGAGCCCATCAAGGACCAATTCCCCATCCTCTCCTACGCCGACTTCTACCAG
CTCGCTGGAGTCGTGGCCGTCGAGGTGACCGGCGGACCTGAGGTTCCATTCCACCCGGGCAGA
CAG
GACAAGCCTGAGCCTCCTCCAGAAGGCCGCCTTCCTGATGCCACCCAAGGCTCTGACCACCTCAGGCAGGTATTTTCCACTCAGATGGGTTTGAGCGACCAGGACATTGTTGCGCTT
TCTGGTGGTCACACCCTG
GGAAGGTGCCACAAGGAAAGATCTGGCTTTGAGGGAGCGTGGACTGCCAACCCTTTGATCTTTGACAACTCGTACTTCAAGGAGCTCCTGAGTGGCGAGAAG
GAAGGCCTTCTTCAGTTGCCGACTGACAAAACCCTCCTGTCCGACCCGGCCTTCCGCCCACTCGTGGATAAATATGCTGCG
GATGAGGATGCTTTCTTTGCTGACTATGCTGAGGCACAC
CTGAAGCTCTCTGAGTTGGG
ATTTGGCGGGTACTTCGAAGGTTGTTGCTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCGCCCACAT TCAATTCAAT TCCCCATCGC GCAGCCATGG CCGCCAAGTG CTACCCAACA GTCACCGATG AGTACCAGAC GGCCGTCGCC AAGGCCAAGC GCAAGCTCCG CGGCCTCATC  GCCGAGAAGA ACTGCGCCCC TCTCATGCTG CGCCTCGCGT GGCACTCGGC GGGGACCTTC GACGTCGCCA CCAAGACCGG CGGCCCCTTC GGAACCATCA AGTGCCCCGC GGAGCTCGCG  CACGGCGCCA ACGCGGGCCT CGACATCGCC GTCAGGCTAC TCGAGCCCAT CAAGGACCAA TTCCCCATCC TCTCCTACGC CGACTTCTAC CAGCTCGCTG GAGTCGTGGC CGTCGAGGTG  ACCGGCGGAC CTGAGGTTCC ATTCCACCCG GGCAGACAGG ACAAGCCTGA GCCTCCTCCA GAAGGCCGCC TTCCTGATGC CACCCAAGGC TCTGACCACC TCAGGCAGGT ATTTTCCACT  CAGATGGGTT TGAGCGACCA GGACATTGTT GCGCTTTCTG GTGGTCACAC CCTGGGAAGG TGCCACAAGG AAAGATCTGG CTTTGAGGGA GCGTGGACTG CCAACCCTTT GATCTTTGAC  AACTCGTACT TCAAGGAGCT CCTGAGTGGC GAGAAGGAAG GCCTTCTTCA GTTGCCGACT GACAAAACCC TCCTGTCCGA CCCGGCCTTC CGCCCACTCG TGGATAAATA TGCTGCGGAT  GAGGATGCTT TCTTTGCTGA CTATGCTGAG GCACACCTGA AGCTCTCTGA GTTGGGATTT GGCGGGTACT TCGAAGGTTG TTGCTGATTC TGGTTTGGTG CATGAAGTTG GTATGAAGGC  GAAGAAGAAG AATAAAATTG TGGGCCTGAG GCCATGTGAT GTGTTGTTTG GATTTGGTTA GATGGACGTT GGAATTCCAT TGTGTTGCTT GCTTGACATC TATGAGCATA TTGTTGGAGG  GACGATGGAA ATGTTATGTA ACTTACCTGT TCCCTCCGTC TAAGATGAAC CGGAAATTTG TTTACCCTCT GTCGGCTGGG TTCATTTCTG GAACCAAATT TCACTGTTTT AATTATTTTG  TCTTGGTGTC AGCTTGTTTG TTCACGACCA TTCGTGCATC TTTTTTTGTT TCTTGTCAAA TAGTTTTTAC ACTTATAAAG ATTTTACACT CACAAAGATT TGAGTTTACA TTTGTAAAGA  TCTGAGTTGG TGGTCGCGAG TTCATTCTAA CAAGACAACT ACTTAAGGCT ATAGGAATCA TCTAATTGTG ACTCATTTTA TACGTATCAT GATCTTTTGA CTATGGTTGA TTGGTTTTCA 
TGACTTTCAA GAGTAATTGT ATTTTTCAAA AATAATAT 

Retrieve as FASTA