Entry information : BdiPrx36 (Bradi1g59520)
Entry ID 7910
Creation 2011-01-17 (Toky Ramarohetra)
Last sequence changes 2011-01-17 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx36 (Bradi1g59520)
Name (synonym) BdiPrx36 (Bradi1g59520)
Class Class III peroxidase    [Orthogroup: Prx155]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx36
start..stop
S start..stop
OsPrx96 442 1e-157 34..333 29..328
SiPrx84 417 1e-147 1..333 1..332
ZmPrx89 393 8e-138 31..333 31..337
SbPrx28 383 5e-134 26..333 33..338
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 58552091..58552513 423 N° 2 58551387..58551965 579  
complement(join(58551387..58551965,58552091..58552513))


exon

Literature and cross-references BdiPrx36 (Bradi1g59520)
DNA ref. Phytozome 12:   Bd1 (58552513..58551387)
Protein sequence: BdiPrx36 (Bradi1g59520)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   333 (304)
PWM (Da):   %s   35335.57 (32515.1)  
PI (pH):   %s   5.07 (4.95) Peptide Signal:   %s   cut: 30 range:30-333
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSSSSSRTTILLLMAAAAASLLCLAQAEESPLKQDFYSETCPGVEELVRKELKKIFADDSTIRAGLLRLHFHDCFVRGCDASLMLDSHNGTAEKHADPNLTVRGYEVIEALKLKVEAECPLVVSCADLMTIAARDAVKFSDGPDYPVETGRRDGNISMAADAKRDLPPADGNVTVLTKYFAAKNLTMKDLVVLSGAHTLGVAHCPSFSGRVHNHTGAGDADPALDAGYLAKLNATCGPANVASVVPLDAATTDKFDLGYYQSVRGRKGLLGSDDALNHDSLMGAYVELMNNASSLDTFFQDFAVSMVKMGRVGVLTGEEGVIRESCTIFVD*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, intron 2), no EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCTTCTTCTTCCTCCAGCAGAACCACGATCCTCCTGCTAATGGCGGCGGCGGCGGCGAGCCTCCTCTGCCTGGCGCAAGCAGAGGAGTCGCCGCTGAAGCAGGACTTCTACAGC
GAGACGTGCCCTGGCGTGGAGGAGCTGGTGCGTAAGGAGCTGAAGAAGATCTTCGCCGACGACTCCACCATCCGGGCGGGGCTCCTCCGGCTGCACTTCCACGACTGCTTCGTCCGCGGC
TGCGACGCGTCCCTGATGCTCGACTCCCACAACGGCACCGCCGAGAAGCACGCCGACCCCAACCTCACCGTCCGCGGATACGAGGTCATCGAGGCCCTCAAGCTCAAGGTCGAGGCCGAA
TGCCCCCTCGTCGTCTCCTGCGCCGACCTCATGACCATCGCCGCCCGCGACGCCGTCAAATTC
GTAAGCCCCCTTCTTCTTCCCCAGCTCCGGCCGCCATTAATAAATCCTCTGTTCTTC
TTCTTCTTCGCCAGCTCCGGCAGCCATAAAATTCCTCTGTTTTGCTGAAATCCATTAAATATTTGCAGAGCGATGGTCCGGACTACCCGGTGGAGACAGGGCGTCGGGACGGCAACATCT
CCATGGCAGCCGACGCGAAGCGCGACCTGCCGCCGGCGGACGGCAACGTGACCGTCCTCACAAAGTACTTCGCCGCCAAGAACCTCACAATGAAAGACCTCGTGGTCCTCTCCGGCGCGC
ACACTCTGGGCGTCGCCCACTGCCCGTCCTTCTCTGGCCGCGTGCACAACCACACCGGCGCCGGGGACGCCGACCCGGCGCTGGACGCCGGCTACCTGGCCAAGCTCAACGCCACCTGCG
GGCCGGCGAACGTCGCCAGCGTCGTGCCGCTGGACGCGGCCACCACGGACAAGTTCGACCTGGGGTATTACCAGTCGGTGCGTGGCCGGAAGGGGCTGCTGGGCTCCGACGACGCGCTCA
ACCATGACAGCCTCATGGGCGCCTATGTCGAGCTCATGAACAATGCGTCGTCGCTTGACACATTCTTCCAAGACTTTGCTGTGTCCATGGTTAAGATGGGCAGGGTCGGCGTGCTCACCG
GAGAAGAAGGCGTGATCAGGGAGAGCTGCACAATCTTCGTCGACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCTTCTTCTTCCTCCAGCAGAACCACGATCCTCCTGCTAATGGCGGCGGCGGCGGCGAGCCTCCTCTGCCTGGCGCAAGCAGAGGAGTCGCCGCTGAAGCAGGACTTCTACAGC
GAGACGTGCCCTGGCGTGGAGGAGCTGGTGCGTAAGGAGCTGAAGAAGATCTTCGCCGACGACTCCACCATCCGGGCGGGGCTCCTCCGGCTGCACTTCCACGACTGCTTCGTCCGCGGC
TGCGACGCGTCCCTGATGCTCGACTCCCACAACGGCACCGCCGAGAAGCACGCCGACCCCAACCTCACCGTCCGCGGATACGAGGTCATCGAGGCCCTCAAGCTCAAGGTCGAGGCCGAA
TGCCCCCTCGTCGTCTCCTGCGCCGACCTCATGACCATCGCCGCCCGCGACGCCGTCAAATTC
AGCGATGGTCCGGACTACCCGGTGGAGACAGGGCGTCGGGACGGCAACATCTCCATG
GCAGCCGACGCGAAGCGCGACCTGCCGCCGGCGGACGGCAACGTGACCGTCCTCACAAAGTACTTCGCCGCCAAGAACCTCACAATGAAAGACCTCGTGGTCCTCTCCGGCGCGCACACT
CTGGGCGTCGCCCACTGCCCGTCCTTCTCTGGCCGCGTGCACAACCACACCGGCGCCGGGGACGCCGACCCGGCGCTGGACGCCGGCTACCTGGCCAAGCTCAACGCCACCTGCGGGCCG
GCGAACGTCGCCAGCGTCGTGCCGCTGGACGCGGCCACCACGGACAAGTTCGACCTGGGGTATTACCAGTCGGTGCGTGGCCGGAAGGGGCTGCTGGGCTCCGACGACGCGCTCAACCAT
GACAGCCTCATGGGCGCCTATGTCGAGCTCATGAACAATGCGTCGTCGCTTGACACATTCTTCCAAGACTTTGCTGTGTCCATGGTTAAGATGGGCAGGGTCGGCGTGCTCACCGGAGAA
GAAGGCGTGATCAGGGAGAGCTGCACAATCTTCGTCGACTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCTT CTTCTTCCTC CAGCAGAACC ACGATCCTCC TGCTAATGGC GGCGGCGGCG GCGAGCCTCC TCTGCCTGGC GCAAGCAGAG GAGTCGCCGC TGAAGCAGGA CTTCTACAGC  GAGACGTGCC CTGGCGTGGA GGAGCTGGTG CGTAAGGAGC TGAAGAAGAT CTTCGCCGAC GACTCCACCA TCCGGGCGGG GCTCCTCCGG CTGCACTTCC ACGACTGCTT CGTCCGCGGC  TGCGACGCGT CCCTGATGCT CGACTCCCAC AACGGCACCG CCGAGAAGCA CGCCGACCCC AACCTCACCG TCCGCGGATA CGAGGTCATC GAGGCCCTCA AGCTCAAGGT CGAGGCCGAA  TGCCCCCTCG TCGTCTCCTG CGCCGACCTC ATGACCATCG CCGCCCGCGA CGCCGTCAAA TTCAGCGATG GTCCGGACTA CCCGGTGGAG ACAGGGCGTC GGGACGGCAA CATCTCCATG  GCAGCCGACG CGAAGCGCGA CCTGCCGCCG GCGGACGGCA ACGTGACCGT CCTCACAAAG TACTTCGCCG CCAAGAACCT CACAATGAAA GACCTCGTGG TCCTCTCCGG CGCGCACACT  CTGGGCGTCG CCCACTGCCC GTCCTTCTCT GGCCGCGTGC ACAACCACAC CGGCGCCGGG GACGCCGACC CGGCGCTGGA CGCCGGCTAC CTGGCCAAGC TCAACGCCAC CTGCGGGCCG  GCGAACGTCG CCAGCGTCGT GCCGCTGGAC GCGGCCACCA CGGACAAGTT CGACCTGGGG TATTACCAGT CGGTGCGTGG CCGGAAGGGG CTGCTGGGCT CCGACGACGC GCTCAACCAT  GACAGCCTCA TGGGCGCCTA TGTCGAGCTC ATGAACAATG CGTCGTCGCT TGACACATTC TTCCAAGACT TTGCTGTGTC CATGGTTAAG ATGGGCAGGG TCGGCGTGCT CACCGGAGAA  GAAGGCGTGA TCAGGGAGAG CTGCACAATC TTCGTCGACT GATCGCCCAA TTAGTTTTGC CAATTTCTTT CTTTTCTGCT GCCTCTCGTC GATTGATGCT AATATATGAT GATGCACCGG 
CTTTGTTTCC AATTTCTTTT TTTGTTGCTT GTAATGCTTT ATCATTGGTG GCTTTTTGGA ACATTAATTC GTTATTTCTT GATTCTAATT AATTGTTTTC TT 

Retrieve as FASTA