Entry information : BdiPrx39 (Bradi1g61530)
Entry ID 7911
Creation 2011-01-17 (Toky Ramarohetra)
Last sequence changes 2011-01-17 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx39 (Bradi1g61530)
Name (synonym) BdiPrx39 (Bradi1g61530)
Class Class III peroxidase    [Orthogroup: Prx094]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx39
start..stop
S start..stop
OsPrx47 530 0 3..338 4..332
OsPrx48 524 0 1..337 1..339
SbPrx15 518 0 10..337 6..332
ZmPrx145 513 0 5..337 7..336
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 60891444..60891686 243 N° 2 60890531..60891304 774  
complement(join(60890531..60891304,60891444..60891686))


exon

Literature and cross-references BdiPrx39 (Bradi1g61530)
DNA ref. Phytozome 12:   Bd1 (60891686..60890531)
EST ref. GenBank:   DV486744.1 [5' end]   DV488877.1 [5' end]
Protein sequence: BdiPrx39 (Bradi1g61530)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   338 (316)
PWM (Da):   %s   35668.07 (33468.9)  
PI (pH):   %s   5.97 (5.66) Peptide Signal:   %s   cut: 23 range:23-338
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGKVAATLVVPALLMALAFCQAAGYYEPPSPGKCGLTVGYYHESCPHAEDIVKGVVAEAVRRNPGIGAGLIRMLFHDCFVEGCDASVLLDPTPANPQPEKLSPPNFPSLRGFEVIDAAKDILEKACPGVVSCADIVAFAARDASFFLSKRGRGVAFQMPAGRLDGRVSIASRALDLLPPPTFGLAQLVDNFAAKGLSAEDMVVLSGSHTVGRSHCSSFVPDRLAVPSDIDPALGTSLRGQCPASPSPADDPTVVQDVVTPGKLDNQYYKNVLAHKVLFTSDAALLASAETAKMVLDNANIPGWWEDRFEVAMVKMASIEVKTGRGDGEVRRNCRVVNY*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 1 intron), 2 ESTs. Cultivar="Bd21".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTAAGGTTGCTGCGACTCTGGTCGTCCCTGCGTTGCTCATGGCATTGGCTTTCTGCCAAGCTGCTGGCTACTACGAGCCTCCTAGCCCCGGTAAGTGCGGGCTCACCGTCGGGTAC
TACCACGAAAGCTGCCCGCACGCCGAGGACATTGTCAAGGGCGTCGTCGCAGAAGCTGTCCGCCGGAACCCCGGCATCGGCGCCGGCCTCATCCGTATGCTCTTCCACGACTGCTTCGTC
GAG
GTAATATTTGTCTTATCACGGCAAATTTGCACGAAACACGTGACCATGCATGCATGATTGTGCTGTTGACACTCTTGTCACGAAAGATTTGAGCTTACCATTTTACGTGCAACCAAT
AATGCAAATGTCAACAACTCAGGGCTGCGACGCGTCCGTCCTGCTGGACCCGACGCCGGCCAACCCGCAGCCGGAGAAGCTGAGCCCGCCCAACTTCCCGAGCCTCCGCGGCTTCGAGGT
GATCGACGCGGCAAAGGACATCCTCGAGAAGGCCTGCCCGGGCGTCGTCTCCTGCGCCGACATCGTCGCCTTCGCCGCGCGCGACGCCTCCTTCTTCCTAAGCAAGCGCGGGCGCGGCGT
GGCGTTCCAAATGCCGGCGGGCCGCCTGGACGGCCGCGTCTCCATTGCCTCGCGCGCGCTCGACCTCCTCCCGCCGCCCACCTTCGGCCTCGCGCAGCTCGTGGACAACTTCGCAGCCAA
GGGGCTCAGCGCCGAGGACATGGTGGTGCTCTCGGGGTCACACACCGTGGGCCGCTCCCACTGCTCGTCCTTCGTGCCCGACCGCCTCGCCGTGCCCTCTGACATCGACCCGGCGCTCGG
CACGTCGCTGAGGGGCCAGTGCCCGGCGAGCCCGAGCCCGGCTGACGACCCCACAGTGGTGCAGGACGTCGTGACGCCCGGCAAGCTCGACAACCAGTACTACAAGAACGTGCTGGCGCA
CAAGGTGCTCTTCACCTCCGACGCGGCGCTCCTGGCCTCGGCGGAGACGGCCAAGATGGTGCTGGACAACGCCAACATCCCCGGGTGGTGGGAGGACCGCTTCGAGGTTGCCATGGTGAA
GATGGCCAGCATCGAGGTCAAGACCGGCCGCGGCGACGGCGAGGTCAGGAGGAACTGCCGGGTTGTCAACTACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTAAGGTTGCTGCGACTCTGGTCGTCCCTGCGTTGCTCATGGCATTGGCTTTCTGCCAAGCTGCTGGCTACTACGAGCCTCCTAGCCCCGGTAAGTGCGGGCTCACCGTCGGGTAC
TACCACGAAAGCTGCCCGCACGCCGAGGACATTGTCAAGGGCGTCGTCGCAGAAGCTGTCCGCCGGAACCCCGGCATCGGCGCCGGCCTCATCCGTATGCTCTTCCACGACTGCTTCGTC
GAG
GGCTGCGACGCGTCCGTCCTGCTGGACCCGACGCCGGCCAACCCGCAGCCGGAGAAGCTGAGCCCGCCCAACTTCCCGAGCCTCCGCGGCTTCGAGGTGATCGACGCGGCAAAGGAC
ATCCTCGAGAAGGCCTGCCCGGGCGTCGTCTCCTGCGCCGACATCGTCGCCTTCGCCGCGCGCGACGCCTCCTTCTTCCTAAGCAAGCGCGGGCGCGGCGTGGCGTTCCAAATGCCGGCG
GGCCGCCTGGACGGCCGCGTCTCCATTGCCTCGCGCGCGCTCGACCTCCTCCCGCCGCCCACCTTCGGCCTCGCGCAGCTCGTGGACAACTTCGCAGCCAAGGGGCTCAGCGCCGAGGAC
ATGGTGGTGCTCTCGGGGTCACACACCGTGGGCCGCTCCCACTGCTCGTCCTTCGTGCCCGACCGCCTCGCCGTGCCCTCTGACATCGACCCGGCGCTCGGCACGTCGCTGAGGGGCCAG
TGCCCGGCGAGCCCGAGCCCGGCTGACGACCCCACAGTGGTGCAGGACGTCGTGACGCCCGGCAAGCTCGACAACCAGTACTACAAGAACGTGCTGGCGCACAAGGTGCTCTTCACCTCC
GACGCGGCGCTCCTGGCCTCGGCGGAGACGGCCAAGATGGTGCTGGACAACGCCAACATCCCCGGGTGGTGGGAGGACCGCTTCGAGGTTGCCATGGTGAAGATGGCCAGCATCGAGGTC
AAGACCGGCCGCGGCGACGGCGAGGTCAGGAGGAACTGCCGGGTTGTCAACTACTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AACTAGGCGC TAGTTGCAAT CCTCAAGAGC GCAGTAGTGT CTGATTTCAT ATACACAAGA GAATCGAGCA TGGGTAAGGT TGCTGCGACT CTGGTCGTCC CTGCGTTGCT CATGGCATTG  GCTTTCTGCC AAGCTGCTGG CTACTACGAG CCTCCTAGCC CCGGTAAGTG CGGGCTCACC GTCGGGTACT ACCACGAAAG CTGCCCGCAC GCCGAGGACA TTGTCAAGGG CGTCGTCGCA  GAAGCTGTCC GCCGGAACCC CGGCATCGGC GCCGGCCTCA TCCGTATGCT CTTCCACGAC TGCTTCGTCG AGGGCTGCGA CGCGTCCGTC CTGCTGGACC CGACGCCGGC CAACCCGCAG  CCGGAGAAGC TGAGCCCGCC CAACTTCCCG AGCCTCCGCG GCTTCGAGGT GATCGACGCG GCAAAGGACA TCCTCGAGAA GGCCTGCCCG GGCGTCGTCT CCTGCGCCGA CATCGTCGCC  TTCGCCGCGC GCGACGCCTC CTTCTTCCTA AGCAAGCGCG GGCGCGGCGT GGCGTTCCAA ATGCCGGCGG GCCGCCTGGA CGGCCGCGTC TCCATTGCCT CGCGCGCGCT CGACCTCCTC  CCGCCGCCCA CCTTCGGCCT CGCGCAGCTC GTGGACAACT TCGCAGCCAA GGGGCTCAGC GCCGAGGACA TGGTGGTGCT CTCGGGGTCA CACACCGTGG GCCGCTCCCA CTGCTCGTCC  TTCGTGCCCG ACCGCCTCGC CGTGCCCTCT GACATCGACC CGGCGCTCGG CACGTCGCTG AGGGGCCAGT GCCCGGCGAG CCCGAGCCCG GCTGACGACC CCACAGTGGT GCAGGACGTC  GTGACGCCCG GCAAGCTCGA CAACCAGTAC TACAAGAACG TGCTGGCGCA CAAGGTGCTC TTCACCTCCG ACGCGGCGCT CCTGGCCTCG GCGGAGACGG CCAAGATGGT GCTGGACAAC  GCCAACATCC CCGGGTGGTG GGAGGACCGC TTCGAGGTTG CCATGGTGAA GATGGCCAGC ATCGAGGTCA AGACCGGCCG CGGCGACGGC GAGGTCAGGA GGAACTGCCG GGTTGTCAAC  TACTAGCTCT AATCGTCATC AATTCTATCT TATTCGTGCG TGTGCCGCTC TTGATTCTGC TTGCTTAATT CGTTTAAGTG TATGTATTTC ATTTCCTTTG TACGCGGTAC GGCGACCATG 
TACTTGCTTG TACTACTGTA TCATCATTTG CAGATTGGAA TAGCAATAAC AATGAGTCCG GCTACGGCTT AGTCCATCTC AAGCCACCAA ATCAT 

Retrieve as FASTA