Entry information : BdiPrx96 (Bradi3g09080)
Entry ID 7915
Creation 2011-01-17 (Toky Ramarohetra)
Last sequence changes 2011-01-17 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx96 (Bradi3g09080)
Name (synonym) BdiPrx96 (Bradi3g09080)
Class Class III peroxidase    [Orthogroup: Prx117]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx96
start..stop
S start..stop
SofPrx08 478 1e-171 20..322 22..324
OsPrx27 471 5e-169 26..322 27..321
SiPrx76 465 1e-166 29..322 31..325
SbPrx71 458 7e-164 23..322 26..325
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 7186250..7186468 219 N° 2 7186579..7186770 192 N° 3 7187100..7187657 558  
join(7186250..7186468,7186579..7186770,7187100..7187657)


exon

Literature and cross-references BdiPrx96 (Bradi3g09080)
DNA ref. Phytozome 12:   Bd3 (7186250..7187657)
EST ref. GenBank:   DV481478.1 [Fragment]   DV483889.1 [Fragment]
Protein sequence: BdiPrx96 (Bradi3g09080)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (296)
PWM (Da):   %s   33396.81 (30879.3) Transmb domain:   %s   i7-26o
PI (pH):   %s   8.4 (7.98) Peptide Signal:   %s   cut: 27 range:27-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAMRRVLVAAVALATASLLVPAAVAQLSPSFYGASCTSLESIVRSGMVSAVQSEPRMGASILRLFFHDCFVNGCDASVLLDDSSTLTGEKNAGPNANSLRGYEVIDAIKSRVEAACPGTVSCADILAVAARDGVNLLGGPTWAVPLGRRDARTTTQQAANANLPSPSSAIGTLISSFASKGLDSQDLVALSGGHTIGAARCASFRSRVYNDSNILAGFAQRRRQVCPAQGPNGDGNLAPLDAFSSVKFDNGYFRNLQGRFGLLHSDQELFNGGPVDSIVQRYARDGGAFAGDFVNAMIKMGNISPLTGANGEIRANCRKPN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, intron 1 & 2), 2 ESTs. Cultivar="Bd21".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCGATGAGGAGAGTGTTGGTGGCCGCAGTAGCGCTGGCCACGGCCTCGCTGCTCGTCCCCGCCGCCGTGGCTCAGCTCTCGCCGTCGTTCTACGGCGCCAGCTGCACGAGCCTG
GAGTCCATCGTGCGGTCGGGGATGGTTTCCGCTGTCCAGAGCGAGCCCCGGATGGGCGCCTCCATACTCCGCCTCTTCTTCCACGACTGCTTCGTCAAC
GTACGCACATACATACTCTCT
GCTCCCTCGATCAAAAACTCTTCCTTGCTACTCTGCTCTGTAGTCTGTACTCATTGGAATGGCCTGGGGGCATCCATCGATTTTGGCAGGGCTGCGACGCGTCGGTGCTGCTGGACGACT
CGTCGACGCTGACGGGGGAGAAGAACGCCGGGCCGAACGCCAACTCGCTGCGCGGCTACGAGGTGATCGACGCCATCAAGTCCCGGGTCGAGGCAGCCTGCCCCGGCACCGTCTCCTGCG
CCGACATCCTCGCCGTCGCCGCCCGCGACGGCGTCAACCTG
GTGAGTGTCAGCGCGAGCGCGAACTTATTACCGTGCATCATTGCCCCCACCAGTCAAAATACATATGGATTTACCGTAC
GTCATCCTGCCGACACCCAGTACAACGAACTCGCTGTCCGAAAAAAAAAAGGTTTGCTCCATTTCTAACAACCGCGCATGCACGCGCGACAAATTAGTCCGCACACGTTCTCTGACACGT
GGGCCGGGTTTCTTTCCGCAACCGCCTGCACTTTCTCTGGTGGATCTCATTCTCATGAGAATGGCACCGCTGCTGGCTGTGTCTATCAATTTGTTCACATGACAACGATGACGACGTTGT
AATAATGCAGCTAGGTGGGCCGACTTGGGCGGTGCCGCTGGGCCGGCGCGACGCGCGGACGACGACGCAGCAGGCCGCGAACGCCAACCTACCCTCGCCGTCATCGGCAATCGGCACGCT
CATCTCGTCGTTCGCGTCCAAGGGGCTCGACAGCCAGGACCTGGTGGCGCTGTCGGGCGGGCACACGATCGGCGCGGCCCGGTGCGCGAGCTTCCGTTCCCGCGTGTACAACGACAGCAA
CATCCTGGCCGGGTTCGCGCAGCGGCGGCGGCAGGTGTGCCCGGCCCAGGGGCCCAACGGCGACGGCAACCTGGCCCCGCTGGACGCCTTCAGCTCCGTCAAGTTCGACAACGGCTACTT
CCGCAACCTGCAGGGCCGCTTCGGCCTGCTCCACTCCGACCAGGAGCTCTTCAACGGCGGGCCCGTCGACTCCATCGTGCAGCGGTACGCGCGCGACGGGGGCGCCTTCGCGGGCGACTT
CGTCAACGCCATGATCAAGATGGGCAACATCAGCCCGCTCACGGGAGCCAACGGCGAGATCCGGGCCAACTGCAGGAAACCCAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCGATGAGGAGAGTGTTGGTGGCCGCAGTAGCGCTGGCCACGGCCTCGCTGCTCGTCCCCGCCGCCGTGGCTCAGCTCTCGCCGTCGTTCTACGGCGCCAGCTGCACGAGCCTG
GAGTCCATCGTGCGGTCGGGGATGGTTTCCGCTGTCCAGAGCGAGCCCCGGATGGGCGCCTCCATACTCCGCCTCTTCTTCCACGACTGCTTCGTCAAC
GGCTGCGACGCGTCGGTGCTG
CTGGACGACTCGTCGACGCTGACGGGGGAGAAGAACGCCGGGCCGAACGCCAACTCGCTGCGCGGCTACGAGGTGATCGACGCCATCAAGTCCCGGGTCGAGGCAGCCTGCCCCGGCACC
GTCTCCTGCGCCGACATCCTCGCCGTCGCCGCCCGCGACGGCGTCAACCTG
CTAGGTGGGCCGACTTGGGCGGTGCCGCTGGGCCGGCGCGACGCGCGGACGACGACGCAGCAGGCCGCG
AACGCCAACCTACCCTCGCCGTCATCGGCAATCGGCACGCTCATCTCGTCGTTCGCGTCCAAGGGGCTCGACAGCCAGGACCTGGTGGCGCTGTCGGGCGGGCACACGATCGGCGCGGCC
CGGTGCGCGAGCTTCCGTTCCCGCGTGTACAACGACAGCAACATCCTGGCCGGGTTCGCGCAGCGGCGGCGGCAGGTGTGCCCGGCCCAGGGGCCCAACGGCGACGGCAACCTGGCCCCG
CTGGACGCCTTCAGCTCCGTCAAGTTCGACAACGGCTACTTCCGCAACCTGCAGGGCCGCTTCGGCCTGCTCCACTCCGACCAGGAGCTCTTCAACGGCGGGCCCGTCGACTCCATCGTG
CAGCGGTACGCGCGCGACGGGGGCGCCTTCGCGGGCGACTTCGTCAACGCCATGATCAAGATGGGCAACATCAGCCCGCTCACGGGAGCCAACGGCGAGATCCGGGCCAACTGCAGGAAA
CCCAACTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GAGGCAGGGG CCTGGCCGGA GCTCTCGCTA TACTGCCATT AGCCAGTAAG AGCTTGCAAT GGCAGCGATG AGGAGAGTGT TGGTGGCCGC AGTAGCGCTG GCCACGGCCT CGCTGCTCGT  CCCCGCCGCC GTGGCTCAGC TCTCGCCGTC GTTCTACGGC GCCAGCTGCA CGAGCCTGGA GTCCATCGTG CGGTCGGGGA TGGTTTCCGC TGTCCAGAGC GAGCCCCGGA TGGGCGCCTC  CATACTCCGC CTCTTCTTCC ACGACTGCTT CGTCAACGGC TGCGACGCGT CGGTGCTGCT GGACGACTCG TCGACGCTGA CGGGGGAGAA GAACGCCGGG CCGAACGCCA ACTCGCTGCG  CGGCTACGAG GTGATCGACG CCATCAAGTC CCGGGTCGAG GCAGCCTGCC CCGGCACCGT CTCCTGCGCC GACATCCTCG CCGTCGCCGC CCGCGACGGC GTCAACCTGC TAGGTGGGCC  GACTTGGGCG GTGCCGCTGG GCCGGCGCGA CGCGCGGACG ACGACGCAGC AGGCCGCGAA CGCCAACCTA CCCTCGCCGT CATCGGCAAT CGGCACGCTC ATCTCGTCGT TCGCGTCCAA  GGGGCTCGAC AGCCAGGACC TGGTGGCGCT GTCGGGCGGG CACACGATCG GCGCGGCCCG GTGCGCGAGC TTCCGTTCCC GCGTGTACAA CGACAGCAAC ATCCTGGCCG GGTTCGCGCA  GCGGCGGCGG CAGGTGTGCC CGGCCCAGGG GCCCAACGGC GACGGCAACC TGGCCCCGCT GGACGCCTTC AGCTCCGTCA AGTTCGACAA CGGCTACTTC CGCAACCTGC AGGGCCGCTT  CGGCCTGCTC CACTCCGACC AGGAGCTCTT CAACGGCGGG CCCGTCGACT CCATCGTGCA GCGGTACGCG CGCGACGGGG GCGCCTTCGC GGGCGACTTC GTCAACGCCA TGATCAAGAT  GGGCAACATC AGCCCGCTCA CGGGAGCCAA CGGCGAGATC CGGGCCAACT GCAGGAAACC CAACTAAAGG ACGGACACAC CGATGGCATC GAGATTCATG GTCGGGACGT CGGGTCGCTT  GACATCGCCA GCTAGTAATT AAGATGGAAC ATTTTGCGAG ATGCGTGGCT TTTTTCTCTG GTGTGGCTGG CGCGAGACGG TGGAGTGCGT GTGAAGGCAA GGGTTGTGAC GAAATAATTA  GGTGGAGTGG CGCTGTCAAG TTGAGGAGAA GGGGGCTAGC TAGCTCGTGC GTGCATGCAT GCATTGTCGC GGCCGGCGAC ACGTACATCA CGGGCGGCAC CGCACCACCT ATTGGCATCG  GCATTTGCTT CGTTGATTAT TTGGTTGCAT TCTTTTTTTG TACCATATGA TGATGGTTAT AGTTTCAGAT GAACGATGAT TGTTTTGCAA GGGAACACAT GAATAATAAA CGCACTGTAT 
GTCCAT 

Retrieve as FASTA