Entry information : BdiPrx130 (Bradi5g14650)
Entry ID 7924
Creation 2011-01-17 (Toky Ramarohetra)
Last sequence changes 2011-01-17 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx130 (Bradi5g14650)
Name (synonym) BdiPrx130 (Bradi5g14650)
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx130
start..stop
S start..stop
SiPrx57 536 0 135..496 20..371
ZmPrx95 529 0 188..496 158..472
SbPrx93 519 0 137..496 4..376
OsPrx5556 516 0 199..496 207..508
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 18077200..18077931 732 N° 2 18076377..18076556 180 N° 3 18075434..18075599 166 N° 4 18074932..18075344 413
complement(join(18074932..18075344,18075434..18075599,18076377..18076556,1807720 0..18077931))


exon

Literature and cross-references BdiPrx130 (Bradi5g14650)
DNA ref. Phytozome 12:   Bd5 (18077931..18074932)
Protein sequence: BdiPrx130 (Bradi5g14650)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   496 (467)
PWM (Da):   %s   50302.5 (47298.0) Transmb domain:   %s   i7-29o
PI (pH):   %s   9.01 (8.80) Peptide Signal:   %s   cut: 30 range:30-496
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGTGRRPQWGVMFMCLALVLSALAAVASSQSPLPAPPARRAAVPSFPPAASRAPKRASGPALSPAPKPASPPSASPAPKPTPRPAASPAPKPSSPLPAPKPPSPPAPAQAPKPSAPPAASPVPKPPSPPPMPSPSRAPKPSPSAPAPAPAQKPSPAPAPAPKASPPTTTPTPVLKPSVPSPAPPPSPANSAPPTSSPALSPSFYAASCPSVELAVNDVVRSASTLDPTIPGKLLRMVFHDCFVEGCDASVLIEGSGTERTDPANLSLGGFNVIDEAKRLLEAVCPATVSCSDIIVLAARDAVTYTGGPSVPVSLGRRDSLVSLASNVRANIIDTGFSVDAMAASFASKGLTLDDLVTLSGGHTIGSAHCGTFRERFHPDANGSMVPVDASMNTDYANELMQTCSSGNSTVTVDCDEGSAKVFDNRYFSNLLDGRGLLRTDAVLVQNATTRAKVSAFAQSQESFFASWAGSYARLTSLGVKTGSDGEIRRLCSSVNG

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, intron 1, 2 and 3), no EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTACGGGTCGGAGGCCGCAATGGGGAGTCATGTTCATGTGCTTGGCGCTGGTCTTGTCGGCGCTTGCGGCGGTCGCCTCGTCTCAGTCGCCGCTTCCGGCGCCGCCGGCTCGAAGA
GCAGCCGTACCGTCGTTTCCACCAGCGGCGTCGCGGGCTCCGAAGCGGGCGTCCGGGCCAGCGTTGTCGCCTGCGCCAAAGCCAGCGTCTCCCCCATCGGCTTCGCCGGCTCCCAAGCCG
ACACCTAGGCCCGCGGCTTCTCCAGCGCCAAAGCCATCGTCTCCACTTCCGGCGCCAAAGCCGCCATCTCCACCCGCGCCGGCGCAGGCGCCGAAGCCATCGGCTCCACCTGCAGCGTCG
CCGGTTCCGAAGCCACCATCTCCACCACCCATGCCGTCGCCATCGCGGGCTCCAAAGCCATCACCCTCAGCGCCGGCGCCGGCTCCGGCTCAAAAACCATCTCCCGCACCGGCACCCGCC
CCGAAAGCGTCTCCTCCTACGACGACCCCGACACCAGTACTGAAACCATCTGTTCCATCTCCGGCACCGCCGCCGTCTCCGGCGAACTCTGCCCCGCCGACGTCTTCGCCGGCGCTCTCG
CCCAGCTTCTACGCCGCCTCCTGCCCGAGCGTGGAGCTGGCGGTGAACGATGTCGTCAGGTCGGCCTCCACCTTGGACCCCACCATCCCCGGCAAGCTCCTCAGGATGGTCTTCCATGAC
TGCTTCGTAGAG
GTAATGGAAAGATTTCGAGTACTCTATTTACTCCACTTGCATTTTGGAAATGTGTTTTACTTGGCGTTCTTGATGTTGGCACACCCTTGTGCTAGATCTAGGATTCAA
TTAATCTGGTATTTCCAGAAAATTATCCTGACGTCATGGCGTTGGAGCATTGCCTCGTGCGTTCAGCGGTGGCCGCAGTAGCTCACTGATGACTAATGTGACATTTTATTCCGATGTGCC
TTGTCATGATCCTTCCCCCCTTCACTACATGAATCTCCAAACAGTTTTTTCTCTTACCCTGCCCATAGTTTCCTGAGGAAACAGTGACGCAAGTGAATGGTATGCCGGACCTATTTCATT
TTGCGTCCATTAATAATGTCGATTGATCCTCTGATCAACAGAATGATCTGGAACTTTTTCTTTAGGAAACGCAATTTTACTAATTGAGCTACATAGGTATATCAGTGAGCCCCCAAACTT
CAACTCGCCTGATACATAGTAGTCTTTGACATGCTACATGCGTGCAACTGATGGCACCTTACAGTTTCAGTTCATCATGTTTCTGAAAGCGCATATGGACAACGGCAGGAATTTATTTAT
TTATTTGCGATCAACGGCAGGAATAATTTTAACTGTGTAATTTTCTTTATCTCAGGGATGCGATGCGTCGGTGCTGATCGAAGGCAGCGGCACGGAGAGGACCGATCCCGCAAACCTCTC
GCTGGGCGGGTTCAATGTCATTGATGAAGCCAAGAGGCTGCTCGAAGCTGTATGCCCTGCAACCGTTTCTTGCAGTGACATTATAGTCCTTGCTGCAAGAGATGCTGTCACATAT
GTAAG
TATCAATGCACCTACCCAAACCCATTGCCCTAATACACTTCGCTGCAGTTTGTGCTTTCTCTTAATTCTCATAAAATTTAAATGTGCTGATAATTGATACATGAATCTGCTTAGAGAAAT
GGTAGTACTAAGCAGGAGTACTTGGTGGACATAGGACATCATAAACTGTCATTGAATGCTGCAACAATCTGATCTTGTACCATCCAATGAATCAAGCGCTCACGGTCCCATATGTAGCAA
TGACTAGTTAATTAGTAAGCCTGTCTAATGATTACATCCAAATACAATGGGGAGGGAGATCCTGAAGAGCTTCCATATAAGTGAGCAACTGAGCATAATCCCAACTTATGTTGGGACCTG
GCCTTTGTATGTGCATGATTTGTATGGCACATGACTGATGGTCCTAAGGGCAAAGGACAAGTAGACATAATTGGAATTCTGAAGCTTGACAACGGATGTGCTTTTGGAAGTTGGAATTGA
CTATGCATTTGCTAATTTCAGGCCAGTAGAGTTGCTGAAACATCCACCATTTCACCTATCTGTTAGTTTTAGATACAGTAGATGATCTGGTGAGATGACAGTAAAAATAAGGCTGCACGT
TATTTTTTGCATGGCTAATCTCCGTTCTTGACGAGAAAAGAAGCAACTAAGCTGAAGAACTAATGCAGGCTGCTATACGCCTGTGTACACTTCATGGGTATAGAAATGCAAAATGTTTTG
AGTGGTACTAGTTCATCAACTGATGTTTGATTATATGTTTGTTCCAAACTAGACCGGAGGACCGTCGGTGCCCGTCTCTCTCGGGCGACGTGATAGCCTTGTCTCGCTAGCCTCCAATGT
CAGAGCAAACATCATTGACACGGGCTTCTCCGTCGACGCTATGGCGGCGAGCTTCGCCTCGAAGGGCCTCACCTTGGACGACCTCGTCACTCTCTCAG
GTACATTCACAACCCTGCTCAG
AGTAAAACAGCAGTTGGCTACACTGGCACTGTGGAATCATCTCACACCAGCACTACCGCTTATGCAGGCGGGCACACCATCGGGTCAGCGCACTGCGGCACATTCCGGGAGCGCTTCCAT
CCTGACGCCAATGGAAGCATGGTGCCCGTTGATGCATCAATGAACACCGACTACGCGAACGAGCTGATGCAGACCTGCTCATCGGGGAACAGCACCGTGACGGTGGACTGCGACGAGGGG
TCGGCGAAGGTGTTCGACAACCGGTACTTCAGCAACCTGCTGGACGGGCGTGGCCTGCTGCGCACGGACGCCGTGCTGGTGCAGAACGCCACGACGAGGGCCAAGGTGTCGGCCTTCGCG
CAGAGTCAGGAGAGCTTCTTCGCCAGCTGGGCCGGCTCGTACGCCAGGCTCACCAGCCTCGGCGTCAAGACAGGATCCGACGGCGAGATCCGGCGGCTCTGCTCCAGCGTCAACGGCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTACGGGTCGGAGGCCGCAATGGGGAGTCATGTTCATGTGCTTGGCGCTGGTCTTGTCGGCGCTTGCGGCGGTCGCCTCGTCTCAGTCGCCGCTTCCGGCGCCGCCGGCTCGAAGA
GCAGCCGTACCGTCGTTTCCACCAGCGGCGTCGCGGGCTCCGAAGCGGGCGTCCGGGCCAGCGTTGTCGCCTGCGCCAAAGCCAGCGTCTCCCCCATCGGCTTCGCCGGCTCCCAAGCCG
ACACCTAGGCCCGCGGCTTCTCCAGCGCCAAAGCCATCGTCTCCACTTCCGGCGCCAAAGCCGCCATCTCCACCCGCGCCGGCGCAGGCGCCGAAGCCATCGGCTCCACCTGCAGCGTCG
CCGGTTCCGAAGCCACCATCTCCACCACCCATGCCGTCGCCATCGCGGGCTCCAAAGCCATCACCCTCAGCGCCGGCGCCGGCTCCGGCTCAAAAACCATCTCCCGCACCGGCACCCGCC
CCGAAAGCGTCTCCTCCTACGACGACCCCGACACCAGTACTGAAACCATCTGTTCCATCTCCGGCACCGCCGCCGTCTCCGGCGAACTCTGCCCCGCCGACGTCTTCGCCGGCGCTCTCG
CCCAGCTTCTACGCCGCCTCCTGCCCGAGCGTGGAGCTGGCGGTGAACGATGTCGTCAGGTCGGCCTCCACCTTGGACCCCACCATCCCCGGCAAGCTCCTCAGGATGGTCTTCCATGAC
TGCTTCGTAGAG
GGATGCGATGCGTCGGTGCTGATCGAAGGCAGCGGCACGGAGAGGACCGATCCCGCAAACCTCTCGCTGGGCGGGTTCAATGTCATTGATGAAGCCAAGAGGCTGCTC
GAAGCTGTATGCCCTGCAACCGTTTCTTGCAGTGACATTATAGTCCTTGCTGCAAGAGATGCTGTCACATAT
ACCGGAGGACCGTCGGTGCCCGTCTCTCTCGGGCGACGTGATAGCCTT
GTCTCGCTAGCCTCCAATGTCAGAGCAAACATCATTGACACGGGCTTCTCCGTCGACGCTATGGCGGCGAGCTTCGCCTCGAAGGGCCTCACCTTGGACGACCTCGTCACTCTCTCAG
GC
GGGCACACCATCGGGTCAGCGCACTGCGGCACATTCCGGGAGCGCTTCCATCCTGACGCCAATGGAAGCATGGTGCCCGTTGATGCATCAATGAACACCGACTACGCGAACGAGCTGATG
CAGACCTGCTCATCGGGGAACAGCACCGTGACGGTGGACTGCGACGAGGGGTCGGCGAAGGTGTTCGACAACCGGTACTTCAGCAACCTGCTGGACGGGCGTGGCCTGCTGCGCACGGAC
GCCGTGCTGGTGCAGAACGCCACGACGAGGGCCAAGGTGTCGGCCTTCGCGCAGAGTCAGGAGAGCTTCTTCGCCAGCTGGGCCGGCTCGTACGCCAGGCTCACCAGCCTCGGCGTCAAG
ACAGGATCCGACGGCGAGATCCGGCGGCTCTGCTCCAGCGTCAACGGCTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGCCGCTCCC GTCGTCAATG CCAAAACAGC AGTAAACGCG CTTTGGCCTT TGGAGCGTGT CACATTAGAT TCTCCGGCCG GGCCAGCATC AGCAGTTGTT TCCTAGCGAC CCACCCAGCG  CTCTCTAGCT AGCTCCTTCT CGCTGCCGCG GTAGATACTG GACTTGTTCT CGCAGGCAGC AGGCGGCGGT GAACTCGTGT GGGCGAGGTC TTGGCTCGCG AGCTTCGTTC ACGCCTTATA  CTCGCTGGTG CATGATACTC GGGCCACCGG AGTATCTTCC GTGATGGGTA CGGGTCGGAG GCCGCAATGG GGAGTCATGT TCATGTGCTT GGCGCTGGTC TTGTCGGCGC TTGCGGCGGT  CGCCTCGTCT CAGTCGCCGC TTCCGGCGCC GCCGGCTCGA AGAGCAGCCG TACCGTCGTT TCCACCAGCG GCGTCGCGGG CTCCGAAGCG GGCGTCCGGG CCAGCGTTGT CGCCTGCGCC  AAAGCCAGCG TCTCCCCCAT CGGCTTCGCC GGCTCCCAAG CCGACACCTA GGCCCGCGGC TTCTCCAGCG CCAAAGCCAT CGTCTCCACT TCCGGCGCCA AAGCCGCCAT CTCCACCCGC  GCCGGCGCAG GCGCCGAAGC CATCGGCTCC ACCTGCAGCG TCGCCGGTTC CGAAGCCACC ATCTCCACCA CCCATGCCGT CGCCATCGCG GGCTCCAAAG CCATCACCCT CAGCGCCGGC  GCCGGCTCCG GCTCAAAAAC CATCTCCCGC ACCGGCACCC GCCCCGAAAG CGTCTCCTCC TACGACGACC CCGACACCAG TACTGAAACC ATCTGTTCCA TCTCCGGCAC CGCCGCCGTC  TCCGGCGAAC TCTGCCCCGC CGACGTCTTC GCCGGCGCTC TCGCCCAGCT TCTACGCCGC CTCCTGCCCG AGCGTGGAGC TGGCGGTGAA CGATGTCGTC AGGTCGGCCT CCACCTTGGA  CCCCACCATC CCCGGCAAGC TCCTCAGGAT GGTCTTCCAT GACTGCTTCG TAGAGGGATG CGATGCGTCG GTGCTGATCG AAGGCAGCGG CACGGAGAGG ACCGATCCCG CAAACCTCTC  GCTGGGCGGG TTCAATGTCA TTGATGAAGC CAAGAGGCTG CTCGAAGCTG TATGCCCTGC AACCGTTTCT TGCAGTGACA TTATAGTCCT TGCTGCAAGA GATGCTGTCA CATATACCGG  AGGACCGTCG GTGCCCGTCT CTCTCGGGCG ACGTGATAGC CTTGTCTCGC TAGCCTCCAA TGTCAGAGCA AACATCATTG ACACGGGCTT CTCCGTCGAC GCTATGGCGG CGAGCTTCGC  CTCGAAGGGC CTCACCTTGG ACGACCTCGT CACTCTCTCA GGCGGGCACA CCATCGGGTC AGCGCACTGC GGCACATTCC GGGAGCGCTT CCATCCTGAC GCCAATGGAA GCATGGTGCC  CGTTGATGCA TCAATGAACA CCGACTACGC GAACGAGCTG ATGCAGACCT GCTCATCGGG GAACAGCACC GTGACGGTGG ACTGCGACGA GGGGTCGGCG AAGGTGTTCG ACAACCGGTA  CTTCAGCAAC CTGCTGGACG GGCGTGGCCT GCTGCGCACG GACGCCGTGC TGGTGCAGAA CGCCACGACG AGGGCCAAGG TGTCGGCCTT CGCGCAGAGT CAGGAGAGCT TCTTCGCCAG  CTGGGCCGGC TCGTACGCCA GGCTCACCAG CCTCGGCGTC AAGACAGGAT CCGACGGCGA GATCCGGCGG CTCTGCTCCA GCGTCAACGG CTGATGGATC GAGTAGCGAT CACAGATTCT  GGATGATGTA ACATGTAATA CAAATACATA GGGATCGGAT GTATTAGCAG CGAGCTGGGG GAATTAGATC GATTCGTTTG TTCTTCTTGT AGCCGATGAC CGAGTCTTTC TTTGTGTAGG 
CCGCCGCATG TAGAGGGCGG CAAGCGGCAT TGCGTTTTAC CTGCAACAGA AAATACCAAA TTAAGCCCAA TAAAATGATG CTCCGTTCAA GTATTTGAA 

Retrieve as FASTA