Entry information : BdiPrx04 (Bradi1g17790)
Entry ID 7927
Creation 2011-01-17 (Toky Ramarohetra)
Last sequence changes 2011-01-17 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx04 (Bradi1g17790)
Name (synonym) BdiPrx04 (Bradi1g17790)
Class Class III peroxidase    [Orthogroup: Prx082]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx04
start..stop
S start..stop
SiPrx127 454 2e-162 1..325 1..322
OsPrx115 449 3e-160 24..324 23..321
ZmPrx56 443 8e-158 6..323 11..322
SbPrx49 432 1e-153 2..323 9..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 14423929..14424138 210 N° 2 14423632..14423826 195 N° 3 14422588..14423163 576  
complement(join(14422588..14423163,14423632..14423826,14423929..14424138))


exon

Literature and cross-references BdiPrx04 (Bradi1g17790)
DNA ref. Phytozome 12:   Bd1 (14424138..14422588)
Protein sequence: BdiPrx04 (Bradi1g17790)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (307)
PWM (Da):   %s   34492.62 (32668.7)  
PI (pH):   %s   4.28 (4.28) Peptide Signal:   %s   cut: 20 range:20-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAILICLAFMAFAAGTGAGSSGELTADYYGDSCPQALATIKFVVGAAILKEPRMGASLVRLHFHDCFVNGCDGSVLLDDTDGMVGEKTAKANNMSVRGFGVIDAIKAAVDTACLGTVVSCADILALAARDSIVALGGSSYEVPLGRRDGTTASKDAADASIPNPFMDLPELLATFHAQGLTLRDLVVLSGAHTLGYSRCVFYRSRLYNETSTLDPAYAASLDEQCSRDGGEEDQEALAALDDTPTTMDTEYYAGLMNGHALLHTDQQLYNGDGGKSDGMVRYYAENQDKFWEDFGKAMVKLGNLSPLTGDEGEVREYCRVVNSQE*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, intron 1 & 2), no EST. Incorrect prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCTATTCTCATCTGCTTAGCCTTCATGGCTTTCGCCGCTGGCACCGGTGCCGGCTCCTCCGGGGAGCTCACAGCCGACTACTACGGCGATTCGTGCCCGCAGGCGCTGGCGACC
ATCAAGTTCGTCGTGGGCGCGGCCATCCTCAAGGAGCCCCGGATGGGCGCCTCCCTCGTCCGCCTCCACTTCCACGACTGCTTCGTCAAC
GTACTTACGCACTGAGAACTTTCACCATTA
AGCAAGCTAGGCCGTGTGTCCGTTGATATGTGGAGCCATGGATGAAGTGTTTCGGTTGTGCTTTGGATGCAGGGGTGCGACGGGTCCGTTCTGCTGGACGACACGGACGGCATGGTCGGG
GAGAAGACGGCCAAGGCCAACAACATGTCGGTGCGAGGGTTCGGCGTCATCGACGCCATCAAGGCGGCAGTCGACACGGCCTGCTTGGGCACCGTCGTCTCCTGCGCTGACATCCTCGCG
CTCGCCGCCCGTGACTCCATTGTCGCT
GTAAGTTCTTCAGTAACTTCAGTCTGTACTACAAGGACTATTTTTTACAGCCAGATCAAATTTTTAGACATGTTCGTCAGACATAGGGGAAAA
CATGCTGAAGATTGTACATGCCTGCACCACAAAGTAGTGGGAAAAGACCACTGAGTAACCGTAAGATAAGCGATGCTTAAAGCACCTTTATGATCAGCAAGACAGCAACACTTCTTAGTC
GACCCAGCTGATGACAAAATTCAACAAGAAAATGGTTAATTTATTTATCTCATCGATCAGATTAGCTCTCTCTGTCTTCCTCCGACAACTTGCAGCTAGCACCCCTTTTCACCCCGAAGA
AACCAAGCCATACCAAACTTGACTCTGTCCAGCCAAAACGACAATTAATCAATGTAACATAATCCCATTTCCAGACAATGGCATTAATGATTGATCATCTTTTTATATGATCGTGGTTCT
TGCATTGCATTGCAGCTGGGAGGGAGCTCGTACGAGGTGCCGCTAGGCCGGCGGGACGGGACGACGGCGAGCAAGGACGCCGCAGACGCCAGCATCCCGAACCCATTCATGGACCTCCCA
GAGCTCCTAGCAACCTTCCACGCCCAGGGGCTGACACTCCGGGACCTAGTCGTGCTCTCGGGCGCGCACACGCTGGGCTACTCCCGCTGCGTCTTCTACCGGAGCCGCCTCTACAACGAG
ACGTCCACCCTGGACCCGGCCTACGCGGCGTCCCTCGACGAGCAGTGCTCGCGCGACGGAGGCGAAGAAGACCAAGAGGCGCTGGCGGCGCTCGACGACACGCCGACGACCATGGACACG
GAGTACTACGCCGGGCTCATGAACGGCCACGCGCTGCTGCACACGGACCAGCAGCTGTATAATGGGGATGGGGGCAAGAGTGATGGGATGGTGAGGTATTATGCTGAGAATCAGGATAAG
TTTTGGGAGGATTTTGGGAAGGCTATGGTGAAGCTGGGGAACTTGAGCCCGCTCACTGGCGATGAAGGCGAGGTCAGGGAGTACTGCCGGGTCGTGAACAGCCAGGAGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCTATTCTCATCTGCTTAGCCTTCATGGCTTTCGCCGCTGGCACCGGTGCCGGCTCCTCCGGGGAGCTCACAGCCGACTACTACGGCGATTCGTGCCCGCAGGCGCTGGCGACC
ATCAAGTTCGTCGTGGGCGCGGCCATCCTCAAGGAGCCCCGGATGGGCGCCTCCCTCGTCCGCCTCCACTTCCACGACTGCTTCGTCAAC
GGGTGCGACGGGTCCGTTCTGCTGGACGAC
ACGGACGGCATGGTCGGGGAGAAGACGGCCAAGGCCAACAACATGTCGGTGCGAGGGTTCGGCGTCATCGACGCCATCAAGGCGGCAGTCGACACGGCCTGCTTGGGCACCGTCGTCTCC
TGCGCTGACATCCTCGCGCTCGCCGCCCGTGACTCCATTGTCGCT
CTGGGAGGGAGCTCGTACGAGGTGCCGCTAGGCCGGCGGGACGGGACGACGGCGAGCAAGGACGCCGCAGACGCC
AGCATCCCGAACCCATTCATGGACCTCCCAGAGCTCCTAGCAACCTTCCACGCCCAGGGGCTGACACTCCGGGACCTAGTCGTGCTCTCGGGCGCGCACACGCTGGGCTACTCCCGCTGC
GTCTTCTACCGGAGCCGCCTCTACAACGAGACGTCCACCCTGGACCCGGCCTACGCGGCGTCCCTCGACGAGCAGTGCTCGCGCGACGGAGGCGAAGAAGACCAAGAGGCGCTGGCGGCG
CTCGACGACACGCCGACGACCATGGACACGGAGTACTACGCCGGGCTCATGAACGGCCACGCGCTGCTGCACACGGACCAGCAGCTGTATAATGGGGATGGGGGCAAGAGTGATGGGATG
GTGAGGTATTATGCTGAGAATCAGGATAAGTTTTGGGAGGATTTTGGGAAGGCTATGGTGAAGCTGGGGAACTTGAGCCCGCTCACTGGCGATGAAGGCGAGGTCAGGGAGTACTGCCGG
GTCGTGAACAGCCAGGAGTGA

Retrieve as FASTA