Entry information : BdiPrx35 (Bradi1g59000 / Bradi1g58997)
Entry ID 7928
Creation 2011-01-17 (Toky Ramarohetra)
Last sequence changes 2011-01-17 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx35 (Bradi1g59000 / Bradi1g58997)
Name (synonym) BdiPrx35 (Bradi1g59000 / Bradi1g58997)
Class Class III peroxidase    [Orthogroup: Prx011]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx35
start..stop
S start..stop
HvPrx35 543 0 11..329 8..326
SiPrx125 482 4e-173 24..329 23..328
ZmPrx125 466 6e-167 24..329 17..320
OsPrx98 461 1e-164 24..329 26..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 58110769..58110996 228 N° 2 58110282..58110648 367 N° 3 58109313..58109707 395  
complement(join(58109313..58109707,58110282..58110648,58110769..58110996))


exon

Literature and cross-references BdiPrx35 (Bradi1g59000 / Bradi1g58997)
DNA ref. Phytozome 12:   Bd1 (58110996..58109313)
EST ref. GenBank:   DV477890.1 [5' end]
Protein sequence: BdiPrx35 (Bradi1g59000 / Bradi1g58997)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (300)
PWM (Da):   %s   34700.59 (31558.9) Transmb domain:   %s   i7-29o
PI (pH):   %s   7.66 (7.98) Peptide Signal:   %s   cut: 30 range:30-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDGMRSFFFFLAAPLLLLLLAATTLCVDAQLRRDYYAGTCPDVESIVRTAVTQKYRQTSITVGATVHLFFHDCFVQGCDASVLVASTANNTAEKDAAANLSLAGDGFDAVIKAKAAVDAVPRCRNKVSCADVLALVTRDAIALAGGPAYAVELGRLDGLSSTAASVPGKLAPPSSTLDQLTALFGSNGLDQTDMVALSGGHTVGLAHCSTFASRLRPTPDPTLSPKFAAQLQTWCPANVDPRTAVPMDTVTPRSFDNQYYKNLQVGMGLLSSDQLLYTDSRTRPTVDAWASSSAAFDRAFVTAITKLGRIGVKTDPSQGNIRRNCAVFN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, intron 1 & 3), 1 EST. Cultivar="Bd21". Incorrect prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATGGCATGAGGTCCTTCTTCTTCTTCTTGGCGGCGCCGCTCCTTCTTCTTCTCCTGGCCGCCACCACCCTGTGCGTGGACGCGCAGCTCCGGCGAGACTACTACGCCGGCACATGC
CCAGACGTGGAGTCCATCGTCCGCACCGCCGTCACGCAGAAGTACCGCCAGACCTCCATCACCGTCGGCGCCACCGTGCACCTCTTCTTCCATGACTGCTTCGTCCAG
GTAACAACTACT
GCTCCCTCCGTCCCATAATTCTTGTCGCGGTTTTAATCAACAACCACCAAATTTTCACGCCGTGCCCCGTGTCATCATATACACGTCATTCATGGCCGTTCGTTGCAGGGCTGTGACGCG
TCGGTGCTGGTGGCGTCCACGGCCAACAACACGGCGGAGAAGGACGCCGCCGCCAACCTCTCGTTGGCAGGGGACGGCTTCGACGCCGTGATCAAGGCCAAGGCCGCCGTGGACGCCGTG
CCGAGGTGTCGCAACAAGGTGTCGTGTGCCGACGTGCTCGCCTTGGTCACCCGCGACGCCATCGCGCTAGCGGGTGGCCCGGCTTACGCCGTGGAGCTCGGACGGCTGGACGGTCTGAGC
TCCACGGCGGCTAGCGTGCCGGGGAAGCTGGCGCCGCCGTCGTCGACCCTTGACCAGCTTACGGCGCTTTTCGGGTCCAACGGGCTCGACCAGACCGACATGGTCGCCCTCTCAG
GTACA
ATAATCTACTTATGGCTTAATTATTAAGGATTTTGCTTGCTTTGCTTGCAATTTGAGATTGAGTTGGTTGGTTGATTTGGACGACGGTGAGAGCTAGGGAGGTGACCCAGGCTTGCACAC
AATGCCAAATCAGGCAGACACCAGCATGCTTACCAGCTGCTCTGTTTTGGAGTGTCCAAAGCTGCCAAACTCTTGTCCGAACCCATCAATGGACCCTAGGACATTGAATACGACGAGGCA
CTATCTACGTGCCGGCCCATGACCTGTCTTGTGAACTATAGTTTGATGGTATTTTTGGTCATTGTCTCAATAATGAAGACTAGTTTAGGTTACCCACGGAAGCTAAACTTATGCTGTTCT
TCTTCTTGTTACAAGCAAATTAAAGCCGCCATGTTGTGTCTCATGCTAGCCGGATCACACTTTTTCAATCTTAACCCTTGAGCTATATCATACTTTTTTTTTGTGAGATCATCATATGGT
ATTGCTCATGTTGAGTATATTAATTATGGTGTGATGACATTGACATGTCCACACATCCTGGTATTTACCTTCTTTTTGGGTGCATGAAGGAGGGCACACGGTGGGGCTGGCCCATTGCAG
CACGTTCGCCAGCCGGCTGCGGCCCACGCCTGACCCGACACTGAGCCCGAAGTTTGCGGCCCAGCTGCAGACGTGGTGCCCGGCAAACGTGGACCCACGGACCGCGGTGCCCATGGACAC
TGTGACGCCGCGGTCCTTCGACAACCAGTACTACAAAAACCTGCAGGTCGGGATGGGCCTTTTGAGCTCGGATCAGCTACTGTACACCGACTCGAGGACTAGGCCCACCGTCGACGCATG
GGCCAGCAGTAGCGCAGCGTTCGACCGGGCCTTCGTCACCGCCATCACCAAGCTGGGCCGCATCGGGGTCAAGACCGACCCGTCCCAAGGGAACATACGCCGCAACTGCGCGGTCTTCAA
CTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATGGCATGAGGTCCTTCTTCTTCTTCTTGGCGGCGCCGCTCCTTCTTCTTCTCCTGGCCGCCACCACCCTGTGCGTGGACGCGCAGCTCCGGCGAGACTACTACGCCGGCACATGC
CCAGACGTGGAGTCCATCGTCCGCACCGCCGTCACGCAGAAGTACCGCCAGACCTCCATCACCGTCGGCGCCACCGTGCACCTCTTCTTCCATGACTGCTTCGTCCAG
GGCTGTGACGCG
TCGGTGCTGGTGGCGTCCACGGCCAACAACACGGCGGAGAAGGACGCCGCCGCCAACCTCTCGTTGGCAGGGGACGGCTTCGACGCCGTGATCAAGGCCAAGGCCGCCGTGGACGCCGTG
CCGAGGTGTCGCAACAAGGTGTCGTGTGCCGACGTGCTCGCCTTGGTCACCCGCGACGCCATCGCGCTAGCGGGTGGCCCGGCTTACGCCGTGGAGCTCGGACGGCTGGACGGTCTGAGC
TCCACGGCGGCTAGCGTGCCGGGGAAGCTGGCGCCGCCGTCGTCGACCCTTGACCAGCTTACGGCGCTTTTCGGGTCCAACGGGCTCGACCAGACCGACATGGTCGCCCTCTCAG
GAGGG
CACACGGTGGGGCTGGCCCATTGCAGCACGTTCGCCAGCCGGCTGCGGCCCACGCCTGACCCGACACTGAGCCCGAAGTTTGCGGCCCAGCTGCAGACGTGGTGCCCGGCAAACGTGGAC
CCACGGACCGCGGTGCCCATGGACACTGTGACGCCGCGGTCCTTCGACAACCAGTACTACAAAAACCTGCAGGTCGGGATGGGCCTTTTGAGCTCGGATCAGCTACTGTACACCGACTCG
AGGACTAGGCCCACCGTCGACGCATGGGCCAGCAGTAGCGCAGCGTTCGACCGGGCCTTCGTCACCGCCATCACCAAGCTGGGCCGCATCGGGGTCAAGACCGACCCGTCCCAAGGGAAC
ATACGCCGCAACTGCGCGGTCTTCAACTGA

Retrieve as FASTA