Entry information : BdiPrx97 (Bradi3g09090)
Entry ID 7930
Creation 2011-01-17 (Toky Ramarohetra)
Last sequence changes 2011-01-17 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx97 (Bradi3g09090)
Name (synonym) BdiPrx97 (Bradi3g09090)
Class Class III peroxidase    [Orthogroup: Prx129]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx97
start..stop
S start..stop
SiPrx78 519 0 25..324 21..320
ZmPrx67 505 0 29..324 25..320
ZmPrx36 501 0 29..324 25..323
SbPrx72 493 6e-178 31..324 26..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 7198563..7198787 225 N° 2 7198862..7199056 195 N° 3 7199124..7199678 555  
join(7198563..7198787,7198862..7199056,7199124..7199678)


exon

Literature and cross-references BdiPrx97 (Bradi3g09090)
DNA ref. Phytozome 12:   Bd3 (7198563..7199678)
Protein sequence: BdiPrx97 (Bradi3g09090)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (296)
PWM (Da):   %s   32942.25 (30248.7) Transmb domain:   %s   i7-29o
PI (pH):   %s   5.25 (4.83) Peptide Signal:   %s   cut: 29 range:29-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRPRPDLLLASAAVIAVALHALAGGSAAQLSAGFYSASCPTVHGVVRQVMSQAVMNDTRSGAAILRLFFHDCFVNGCDASLLLDDTATTPGEKGAGPNAGGSTFGFDVVDSIKTQVEAACPGVVSCADILAIAARDSVNLLGGPSWAVPLGRRDATAPNPSGAATDLPGPDSDLAALVAAFAAKGLTSRDLAALSGAHTVGMARCAHFRTHVYCDDNVSPAFASQQRQACPASGGDASLAPLDALSPNQFDNGYYRSLMSGAGLLRSDQELFNNGAVDSLVRLYGSNANAFSADFAASMITLGNISPLTGSTGEIRLDCRKVNS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, intron 1, 2 and 3), no EST. Incorrect prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGCCGAGACCCGACCTCCTCCTGGCGTCGGCGGCGGTAATCGCGGTTGCTCTGCACGCGCTGGCCGGCGGATCCGCCGCGCAGCTCTCGGCGGGGTTCTACTCCGCGAGCTGCCCC
ACCGTGCACGGCGTCGTGCGGCAGGTCATGTCCCAGGCCGTCATGAACGACACGCGCAGCGGCGCCGCCATCCTCCGCCTCTTCTTCCACGACTGCTTCGTCAAC
GTACTCATCAAGCAT
TTGGCCAGTGCCTTTTTCTTGTGGCTTTATTGACCCTTTGATTGATTGACTGATTCCAGGGCTGCGACGCGTCGCTGCTTCTGGACGACACGGCCACGACGCCGGGGGAGAAGGGCGCCG
GCCCGAACGCCGGCGGGTCGACCTTCGGCTTCGACGTGGTCGACAGCATCAAGACGCAGGTCGAGGCCGCCTGCCCCGGCGTCGTCTCCTGCGCCGACATCCTCGCCATCGCCGCGCGCG
ACAGCGTCAACCTG
GTTAGCCAGCCTCTCTCTCCCCACAACCATTCTTGCCAGTGCATTATTAATTCTTGTGCAATGGCAGCTGGGCGGGCCGAGCTGGGCCGTGCCGCTGGGCCGGCGG
GACGCGACGGCCCCGAACCCGTCGGGCGCGGCGACGGACCTGCCGGGCCCGGACTCGGACCTGGCCGCGCTCGTGGCGGCCTTCGCCGCCAAGGGCCTGACGTCGCGCGACCTGGCGGCG
CTCTCGGGCGCGCACACGGTCGGCATGGCCCGCTGCGCGCACTTTCGGACGCACGTCTACTGCGACGACAACGTGAGCCCGGCGTTCGCGTCGCAGCAGCGGCAGGCGTGCCCGGCCTCC
GGCGGCGACGCCAGCCTCGCGCCGCTCGACGCGCTCAGCCCCAACCAGTTCGACAACGGGTACTACCGGAGCCTCATGTCCGGCGCCGGCCTGCTGCGGTCCGACCAGGAGCTCTTCAAC
AACGGGGCCGTCGACTCCTTGGTGCGCCTGTACGGCTCCAACGCCAACGCCTTCTCCGCCGACTTCGCCGCGTCCATGATCACGCTCGGCAACATCAGCCCGTTGACCGGGTCCACCGGG
GAGATCAGGCTCGACTGCAGGAAAGTGAATTCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGCCGAGACCCGACCTCCTCCTGGCGTCGGCGGCGGTAATCGCGGTTGCTCTGCACGCGCTGGCCGGCGGATCCGCCGCGCAGCTCTCGGCGGGGTTCTACTCCGCGAGCTGCCCC
ACCGTGCACGGCGTCGTGCGGCAGGTCATGTCCCAGGCCGTCATGAACGACACGCGCAGCGGCGCCGCCATCCTCCGCCTCTTCTTCCACGACTGCTTCGTCAAC
GGCTGCGACGCGTCG
CTGCTTCTGGACGACACGGCCACGACGCCGGGGGAGAAGGGCGCCGGCCCGAACGCCGGCGGGTCGACCTTCGGCTTCGACGTGGTCGACAGCATCAAGACGCAGGTCGAGGCCGCCTGC
CCCGGCGTCGTCTCCTGCGCCGACATCCTCGCCATCGCCGCGCGCGACAGCGTCAACCTG
CTGGGCGGGCCGAGCTGGGCCGTGCCGCTGGGCCGGCGGGACGCGACGGCCCCGAACCCG
TCGGGCGCGGCGACGGACCTGCCGGGCCCGGACTCGGACCTGGCCGCGCTCGTGGCGGCCTTCGCCGCCAAGGGCCTGACGTCGCGCGACCTGGCGGCGCTCTCGGGCGCGCACACGGTC
GGCATGGCCCGCTGCGCGCACTTTCGGACGCACGTCTACTGCGACGACAACGTGAGCCCGGCGTTCGCGTCGCAGCAGCGGCAGGCGTGCCCGGCCTCCGGCGGCGACGCCAGCCTCGCG
CCGCTCGACGCGCTCAGCCCCAACCAGTTCGACAACGGGTACTACCGGAGCCTCATGTCCGGCGCCGGCCTGCTGCGGTCCGACCAGGAGCTCTTCAACAACGGGGCCGTCGACTCCTTG
GTGCGCCTGTACGGCTCCAACGCCAACGCCTTCTCCGCCGACTTCGCCGCGTCCATGATCACGCTCGGCAACATCAGCCCGTTGACCGGGTCCACCGGGGAGATCAGGCTCGACTGCAGG
AAAGTGAATTCGTGA

Retrieve as FASTA