Entry information : BdiPrx131 (Bradi5g19860)
Entry ID 7931
Creation 2011-01-18 (Toky Ramarohetra)
Last sequence changes 2014-01-08 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2014-03-28 (Christophe Dunand)
Peroxidase information: BdiPrx131 (Bradi5g19860)
Name (synonym) BdiPrx131 (Bradi5g19860)
Class Class III peroxidase    [Orthogroup: Prx027]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx131
start..stop
S start..stop
HvPrx13 509 0 1..319 4..321
HvPrx15 498 7e-180 1..319 4..321
BdiPrx99 490 1e-176 3..319 2..318
TmPrx06 488 1e-175 1..319 4..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 22777116..22777322 207 N° 2 22777421..22777612 192 N° 3 22777772..22778335 564  
join(22777116..22777322,22777421..22777612,22777772..22778335)


exon

Literature and cross-references BdiPrx131 (Bradi5g19860)
DNA ref. Phytozome 12:   Bd5 (22776958..22778335)
Protein sequence: BdiPrx131 (Bradi5g19860)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319 (297)
PWM (Da):   %s   33973.04 (31609.8) Transmb domain:   %s   i7-29o
PI (pH):   %s   6.23 (5.64) Peptide Signal:   %s   cut: 23 range:23-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ASSCRIWHCLLALFLISSAAYGQLSPTFYAASCPGLQLVVSSTVNSAILAERRMGASLLRLHFHDCFVQGCDGSILLDDVGSFVGEKTAGPNKNSVRGYDVIDRIKQTLEQMCPGVVSCADIVALAARDGRLQLGGPTWEVLLGRRDSTTTSLADANTDLPAPTSNLDVLISAFAKKNLSPRDLTALSGAHTVGFSQCSNFRDHIYNDTNIDTAFAALRKTDCPAAAPAGNTNLSPLDVETQADVFDNAYYRNLVARRGLLHSDQELFNGASQDALVRQYGNNPALFASDFVTAMIKMGSISPLTGATGEIRLNCRVVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, intron 1 and 2). Incorrect prediction from phytozome ( large part of the exon 1 is missing but no start codon found upstream!!!). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCTTCCAGCTGCAGGATCTGGCATTGCCTGCTTGCCCTCTTCCTCATCTCCTCCGCCGCATATGGGCAGCTCTCGCCGACATTCTATGCCGCAAGCTGCCCGGGGCTGCAGTTGGTCGTG
AGCAGCACCGTGAACTCGGCCATCCTCGCTGAGCGCCGCATGGGCGCCTCCCTCCTCAGGCTCCACTTTCATGACTGCTTCGTCCAA
GTAATATTTGAGCCATTAGTTCTTAACAAAACA
TACCTATTTTTATTGGTAATGAAGCCAGGATTGATGATGAACATCATATGTTTATTGTTACGTAGGGCTGTGACGGATCCATTCTTCTGGACGACGTGGGGAGCTTCGTCGGTGAGAAGA
CCGCTGGCCCGAACAAGAACTCTGTGCGCGGCTACGACGTCATTGACCGGATTAAGCAGACCCTGGAGCAAATGTGCCCTGGCGTCGTCTCCTGCGCCGACATCGTCGCCCTTGCTGCAC
GGGACAGCACATTTCTG
GTACATACATACCTTGAACATGTGTTTATTGTATGGTTTTTCCGAAAAGGAGGAGAATTCGAAAACCTCTCGACCTCTTCATGCACTGTTTACTGTAAATACT
AGATATTCCAATACTGGCAACCCTGAGTTCGTACATATTCGATTGGTCGTTTGCAGCTCGGCGGGCCCACTTGGGAGGTCTTGCTCGGCCGACGCGACTCGACGACAACGAGCTTGGCCG
ACGCGAACACCGACCTCCCAGCACCGACGTCGAACCTCGACGTGCTCATCAGCGCGTTCGCCAAGAAGAACCTGAGCCCGCGGGACCTGACGGCGCTCTCCGGCGCGCACACCGTCGGCT
TCTCGCAGTGCTCCAACTTCCGCGACCACATCTACAACGACACCAACATCGACACCGCCTTCGCCGCGCTGCGCAAGACCGATTGCCCGGCCGCAGCCCCCGCCGGCAACACGAACCTCT
CTCCGCTCGACGTAGAGACGCAGGCCGACGTCTTCGACAACGCCTACTACCGCAACCTGGTGGCCCGGCGCGGACTGCTGCACTCGGACCAGGAGCTCTTCAACGGCGCCTCCCAGGACG
CGCTGGTGCGGCAGTACGGCAACAACCCGGCATTGTTCGCCTCTGACTTCGTCACGGCGATGATCAAAATGGGGAGCATAAGCCCGCTCACCGGAGCCACGGGCGAGATCAGGCTCAACT
GCAGGGTCGTCAACGGCTGA

Retrieve as FASTA