Entry information : BdiPrx60
Entry ID 7935
Creation 2011-01-20 (Toky Ramarohetra)
Last sequence changes 2011-01-20 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx60
Name BdiPrx60
Class Class III peroxidase    [Orthogroup: Prx070]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx60
start..stop
S start..stop
BdiPrx59 499 6e-180 6..321 7..324
OsiPrx07 404 1e-142 7..321 4..317
OsPrx07 388 2e-136 7..321 4..308
OsPrx101 387 7e-136 7..321 4..316
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 9588248..9588454 207 N° 2 9586994..9587752 759  
complement(join(9586994..9587752,9588248..9588454))


exon

Literature and cross-references BdiPrx60
DNA ref. Phytozome 12:   Bd2 (9588436..9586994)
Protein sequence: BdiPrx60
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321 (299)
PWM (Da):   %s   34227.13 (31747.9)  
PI (pH):   %s   7.98 (7.68) Peptide Signal:   %s   cut: 23 range:23-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTYRHQLLMVSLLATLMTMSSADLQYNFYDSSCQNVETTIRGVVHGMIDANSSVAAALIRLYFHDCFVMGCDASILLDPTSANGSPEKKAIPLAEAGYKAVDQIKAAVEALCPGKVSCADILALAARDAVLKSAGFYYNVPSGRRDGNVSTAFSVFTNMPSPFFGIDNLVASFARKNLNVDDLVALSGAHAIGVARCSGFTNRLYPNVDPTMDASYADKLKITCPGPPGRDVPDNLVNNSAVPSNTFDNQFFKNAIAKQVLFTSDAALMTRSDTAAKVAENANGLTTWKVRFAASMIKMGNIEVLTGAQGQIRKSCRVVNS*

Retrieve as FASTA  
Remarks No transcript predicted in phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACATACCGGCACCAGCTGCTCATGGTGTCCCTCCTGGCTACGCTCATGACAATGTCATCTGCAGATTTGCAGTACAATTTCTACGACTCGTCATGCCAGAACGTCGAGACGACCATC
AGGGGTGTCGTCCATGGCATGATCGACGCGAACTCCAGTGTTGCTGCTGCCTTAATTCGCTTGTACTTCCATGATTGCTTTGTCATG
GTACGTAATGACTCGTTTTTGTATAATATACTT
ATCCTTTATTTGAATGTCCAGATATGCATCGTTGGCCACTAACATATTGCAAATATATTTATATGATGAGCTGAAAGGTACTCCCACTGTTCAGATTAATTCTTTTGAGTTGAAAAAGGA
TCAAATGTGTCACGGAACCAAGAGACAAAATAAAGAGTGATATGCTACCGTACTTAACTATACTGGGAGTAATATATCATTTAATCTGAGAAAATATAAAAGAACATCAATAAATTTGAA
TATGTCTTATACTATTATGAAACAAGATGGAAGAGAGCTTATACACTTTATACAGAGAGAGAAATGGAGAGAATATTTCTTTTGTAAATATACATTTTATAGCTTACGCAATTAAGCACA
GTCTAGCTAGATTCTAGATCAGTGCACACATATCTATCTTTTTTTTCAAAAATAAATTTTACTTTGAACCAATAGCGCTTTTGCTTTTAATACCAACATCAGGGCTGCGACGCCTCCATC
CTCCTGGACCCGACCAGTGCAAACGGCTCGCCAGAGAAGAAAGCCATCCCCCTGGCCGAGGCTGGGTACAAGGCCGTGGACCAGATCAAGGCGGCCGTCGAGGCCTTGTGCCCCGGGAAG
GTCTCGTGCGCCGACATCCTCGCCTTGGCCGCCCGCGACGCAGTCCTCAAATCAGCCGGCTTCTACTACAACGTTCCCTCCGGCCGGCGCGACGGCAATGTGTCCACTGCCTTCTCCGTC
TTCACCAACATGCCGTCGCCGTTCTTCGGCATCGACAATCTCGTAGCCAGCTTCGCCCGCAAGAATCTCAATGTCGACGACCTCGTGGCTCTGTCCGGAGCGCACGCCATCGGCGTAGCG
CGCTGCTCCGGCTTCACTAACCGGCTGTACCCGAACGTGGACCCTACGATGGACGCCAGCTACGCGGACAAGCTGAAGATCACGTGTCCGGGGCCGCCGGGACGCGACGTGCCGGACAAC
CTGGTGAACAACAGCGCGGTGCCGTCCAATACGTTTGACAACCAGTTCTTCAAGAACGCCATCGCCAAGCAAGTGCTCTTCACGTCGGACGCGGCGCTGATGACCCGCAGCGACACGGCG
GCGAAGGTGGCGGAGAATGCTAATGGCCTGACGACGTGGAAGGTGCGGTTCGCGGCGTCGATGATCAAGATGGGAAACATCGAGGTGCTCACTGGCGCGCAGGGGCAGATCAGGAAGTCT
TGCCGCGTGGTCAACAGCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACATACCGGCACCAGCTGCTCATGGTGTCCCTCCTGGCTACGCTCATGACAATGTCATCTGCAGATTTGCAGTACAATTTCTACGACTCGTCATGCCAGAACGTCGAGACGACCATC
AGGGGTGTCGTCCATGGCATGATCGACGCGAACTCCAGTGTTGCTGCTGCCTTAATTCGCTTGTACTTCCATGATTGCTTTGTCATG
GGCTGCGACGCCTCCATCCTCCTGGACCCGACC
AGTGCAAACGGCTCGCCAGAGAAGAAAGCCATCCCCCTGGCCGAGGCTGGGTACAAGGCCGTGGACCAGATCAAGGCGGCCGTCGAGGCCTTGTGCCCCGGGAAGGTCTCGTGCGCCGAC
ATCCTCGCCTTGGCCGCCCGCGACGCAGTCCTCAAATCAGCCGGCTTCTACTACAACGTTCCCTCCGGCCGGCGCGACGGCAATGTGTCCACTGCCTTCTCCGTCTTCACCAACATGCCG
TCGCCGTTCTTCGGCATCGACAATCTCGTAGCCAGCTTCGCCCGCAAGAATCTCAATGTCGACGACCTCGTGGCTCTGTCCGGAGCGCACGCCATCGGCGTAGCGCGCTGCTCCGGCTTC
ACTAACCGGCTGTACCCGAACGTGGACCCTACGATGGACGCCAGCTACGCGGACAAGCTGAAGATCACGTGTCCGGGGCCGCCGGGACGCGACGTGCCGGACAACCTGGTGAACAACAGC
GCGGTGCCGTCCAATACGTTTGACAACCAGTTCTTCAAGAACGCCATCGCCAAGCAAGTGCTCTTCACGTCGGACGCGGCGCTGATGACCCGCAGCGACACGGCGGCGAAGGTGGCGGAG
AATGCTAATGGCCTGACGACGTGGAAGGTGCGGTTCGCGGCGTCGATGATCAAGATGGGAAACATCGAGGTGCTCACTGGCGCGCAGGGGCAGATCAGGAAGTCTTGCCGCGTGGTCAAC
AGCTAA

Retrieve as FASTA