Entry information : BdiPrx58
Entry ID 7936
Creation 2011-01-20 (Toky Ramarohetra)
Last sequence changes 2011-02-15 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx58
Name BdiPrx58
Class Class III peroxidase    [Orthogroup: Prx190]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx58
start..stop
S start..stop
SbPrx56 473 3e-169 3..335 4..334
OsPrx06 467 4e-167 2..335 3..336
ZmPrx121 461 8e-165 15..335 12..333
SiPrx24 427 1e-151 22..335 22..311
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 9579594..9579833 240 N° 2 9578725..9579492 768  
complement(join(9578725..9579492,9579594..9579833))


exon

Literature and cross-references BdiPrx58
DNA ref. Phytozome 12:   Bd2 (9579737..9578725)
Protein sequence: BdiPrx58
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   335 (302)
PWM (Da):   %s   36187.64 (32758.8) Transmb domain:   %s   i7-29o
PI (pH):   %s   9.87 (9.70) Peptide Signal:   %s   cut: 34 range:34-335
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSGARSVVVLRQFPASVLVLAAWIVFSVASSEAQLEVGFYNSTCPRAEKLIRTVVRAAIRRDPGNGPGLVRLFFHDCFVRGCDASVLLDDVPGSTGTVEKMSQANNPSLRGFGVIGRAKRVVERRCRRTVSCADILAFAARDASFVMGSGIGYYDVPAGRRDGRVSNVSEVLNNLPPSFFNASQLVASFAAKNLTADDMVTLSGAHSFGRTHCATIAFRLFPRLAADMDVSYGRFLRRRCPAATGGRRDPVVELDPVTTLLLDNQYYNNVVAGKVPFTSDATLLTRNDTAALVGLYAGNRTLWATRFADAMVKLGNLDVLTGDQGEIRKFCNRVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, intron 1). No trascript predicted from Phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCGGAGCACGTAGTGTTGTTGTTCTTCGTCAGTTCCCTGCTTCCGTCCTTGTGCTAGCAGCATGGATCGTGTTCTCCGTCGCTTCTTCTGAAGCGCAGCTAGAGGTCGGGTTCTAC
AACAGCACCTGCCCGAGGGCGGAGAAGCTCATCCGCACCGTCGTCCGGGCCGCCATCCGCCGAGACCCCGGCAATGGCCCGGGGCTCGTGCGCCTCTTCTTCCACGACTGCTTCGTCAGG
GTAAATTCCCACGGCGTGCATCCATTCACGGCCAGCTTCATTTTATTTGTAAGCAAGACTGACTGACACACGCTTTGTGTTTTCTGTTTGTGCACGCACAGGGGTGCGACGCGTCGGTGC
TCCTTGACGACGTCCCGGGCAGCACGGGCACCGTGGAGAAGATGTCGCAGGCGAACAACCCGAGCCTGCGCGGGTTCGGCGTCATCGGCCGCGCCAAGCGCGTCGTGGAGCGCCGGTGCC
GGCGCACCGTGTCGTGCGCCGACATCCTGGCCTTCGCGGCGCGGGACGCCAGCTTCGTCATGGGGTCCGGCATCGGCTACTACGACGTGCCGGCGGGCCGCCGCGACGGCCGCGTCTCGA
ACGTGTCGGAGGTGCTCAACAACCTGCCCCCGTCCTTCTTCAACGCCTCCCAGCTCGTGGCCAGCTTCGCCGCCAAGAACCTCACGGCCGACGACATGGTCACGCTCTCCGGCGCGCACT
CCTTCGGCCGCACCCACTGCGCCACCATCGCCTTCCGGCTGTTCCCGCGGCTCGCGGCGGACATGGACGTCTCCTACGGGAGGTTCCTCCGCAGGCGGTGCCCGGCGGCGACGGGGGGCC
GGCGGGACCCCGTGGTGGAGCTGGACCCGGTCACCACGCTCCTGCTCGACAACCAGTACTACAACAACGTGGTGGCCGGCAAGGTGCCGTTCACGTCGGACGCCACGCTGCTGACCCGGA
ACGACACGGCGGCGCTCGTCGGCCTCTACGCAGGCAACCGGACGCTGTGGGCGACGCGGTTCGCGGACGCCATGGTGAAGCTGGGCAACCTCGACGTGCTCACCGGTGACCAAGGGGAGA
TCAGGAAATTTTGCAACAGAGTAAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCGGAGCACGTAGTGTTGTTGTTCTTCGTCAGTTCCCTGCTTCCGTCCTTGTGCTAGCAGCATGGATCGTGTTCTCCGTCGCTTCTTCTGAAGCGCAGCTAGAGGTCGGGTTCTAC
AACAGCACCTGCCCGAGGGCGGAGAAGCTCATCCGCACCGTCGTCCGGGCCGCCATCCGCCGAGACCCCGGCAATGGCCCGGGGCTCGTGCGCCTCTTCTTCCACGACTGCTTCGTCAGG
GGGTGCGACGCGTCGGTGCTCCTTGACGACGTCCCGGGCAGCACGGGCACCGTGGAGAAGATGTCGCAGGCGAACAACCCGAGCCTGCGCGGGTTCGGCGTCATCGGCCGCGCCAAGCGC
GTCGTGGAGCGCCGGTGCCGGCGCACCGTGTCGTGCGCCGACATCCTGGCCTTCGCGGCGCGGGACGCCAGCTTCGTCATGGGGTCCGGCATCGGCTACTACGACGTGCCGGCGGGCCGC
CGCGACGGCCGCGTCTCGAACGTGTCGGAGGTGCTCAACAACCTGCCCCCGTCCTTCTTCAACGCCTCCCAGCTCGTGGCCAGCTTCGCCGCCAAGAACCTCACGGCCGACGACATGGTC
ACGCTCTCCGGCGCGCACTCCTTCGGCCGCACCCACTGCGCCACCATCGCCTTCCGGCTGTTCCCGCGGCTCGCGGCGGACATGGACGTCTCCTACGGGAGGTTCCTCCGCAGGCGGTGC
CCGGCGGCGACGGGGGGCCGGCGGGACCCCGTGGTGGAGCTGGACCCGGTCACCACGCTCCTGCTCGACAACCAGTACTACAACAACGTGGTGGCCGGCAAGGTGCCGTTCACGTCGGAC
GCCACGCTGCTGACCCGGAACGACACGGCGGCGCTCGTCGGCCTCTACGCAGGCAACCGGACGCTGTGGGCGACGCGGTTCGCGGACGCCATGGTGAAGCTGGGCAACCTCGACGTGCTC
ACCGGTGACCAAGGGGAGATCAGGAAATTTTGCAACAGAGTAAACTAG

Retrieve as FASTA