Entry information : SbGPx07 (Sb01g035940 [2.1] / Sobic.001G378700.1 [1.4])
Entry ID 7937
Creation 2011-01-21 (Toky Ramarohetra)
Last sequence changes 2011-03-02 (Catherine Mathe)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-06 (Messaoudi)
Peroxidase information: SbGPx07 (Sb01g035940 [2.1] / Sobic.001G378700.1 [1.4])
Name (synonym) SbGPx07 (Sb01g035940 [2.1] / Sobic.001G378700.1 [1.4])
Class Plant glutathione peroxidase    [Orthogroup: Gpx2007]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbGPx07
start..stop
S start..stop
ZmGPx03-2 301 4e-107 1..163 1..163
ZmGPx01-3 292 2e-103 1..163 1..164
ZmGPx01 289 3e-102 2..164 5..167
SpGPx01 288 7e-102 1..164 1..167
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 59588841..59588879 39 N° 2 59588634..59588710 77 N° 3 59586604..59586665 62 N° 4 59586346..59586464 119
N° 5 59586036..59586203 168 N° 6 59585905..59585937 33  
complement(join(59585905..59585937,59586036..59586203,59586346..59586464,5958660 4..59586665,59588634..59588710,59588841..59588879))


exon

Literature and cross-references SbGPx07 (Sb01g035940 [2.1] / Sobic.001G378700.1 [1.4])
DNA ref. Phytozome 11:   chromosome_1 (59588879..59585905)
Protein sequence: SbGPx07 (Sb01g035940 [2.1] / Sobic.001G378700.1 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   165
PWM (Da):   %s   18291.4  
PI (pH):   %s   8.44
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAASSLHDFIVKDASGKDVHLSTYKGKVLLIVNVASKCGLTNSNYTELTQLYEMYKDGFEILAFPCNQFGGQEPATSEEIVQFVCTRFTAKFPIFDVDVNGEDAAPIYKFLKSSKTGPFGENIKWNFAKFLVDKKGHVIERYAPTTYPLSIQKDIKKLLGSY*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 6 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCCGCCAGCTCCCTCCACGACTTCATCGTCAAGGTTCTGGCTGCTATTATCCTCCTCAGTTCCCTTTTGTTTGAAAACTAATGCACGCCAGGGTACCGTGTCCTACACTCCTAC
TCCTACTGTGTGTGAATCGTGTGCATTATCGTATATATTGCGTGTGTAGGATGCAAGCGGCAAAGATGTGCACCTGAGCACCTACAAGGGCAAGGTTCTCCTCATCGTCAACGTTGCATC
AAAGTG
GTATGGTGCATGACAATCATATTATTGTTCCCTCTGTCAGCATATATAATATTGGAGCGATTGAAATGTAGGACGCTATTCCCGCTTTACGTTTAGCAGAATTTAAGCTAGAAA
ACAGATGATCATATTCTTTTGCCTTTTCTAATTCATTCAAATATGGGAAGTTGAGCTTCGTATACATTAATAGTAAATACCAAAGATGCTTGACAGCGGGCTGAAATGTAGGACGGGGCC
TTTCTCAGATATATATATATTTTTTGAAACCGTCTCTTCGCAGAATTTTTTTTTTTGATTCAAGGTGCTCTTTATTACTCATTAGTGTCAGCCAAATCGCTGATCACTAAACCCTCAATC
TCCTGAGGGACACCCTCCCAAGTGACACACTGTCTACTAGGGAACTTACACCCGAGAGCAGCCAAAGCATGGGCTACACTATTACAGACTCAATTACAAACATTAATACTACTAGACCTG
AGGTCTGTAGCTAACAGGAATTTCATATCTGTTAAAATCCCACCGATCGCAGACAAACGGTAGTCGTCGGACTCCAATGCATCTTTGACAAGAGAAGCATCTGTCTCAATGCACAAGTTC
GCAATCCCCAATCGAGATGCTTCCTGCATTCCAGCTGCACAACCTAGGATTTCTGCATGGAAAGCATTTAACAGGAAACCTTCAGAACCCGCGCCTGCTTTAAGCACTTGGCCTTGATCA
TCTCTTATCACATAGCCCCATCCGCCATTCTTGCTCTCTTTATGAAAGGCTCCATCAGACTATAAGAGTTCAGTTTGAAACATCCATCAGAGGGCTTCTTCCATCTGGGTATCTGACAGT
TGTCCGACAACAGCCCACCTTCTGGTTTTTTCATATAGTTTTCAGCATGCGCTGCCGCCATATAAGCGACCTCTGCAGGTGTACGGTTTCTTCCATTTTCCCTTCTCTTATTTCTCTCAT
CCCACCACATCCACAACAGCAAAATCACTGTAAGTTGCTCTTCTTCTTGTAGTCTCAGGATTGTTTCCATCACCCCTCTGGCTGATCCGGCTTCAAGTAGTGCACATCTGATCCTTTCTA
GGTTCAGTTCACGCCATGCAGTTTTAGCTTCTTTGCATTTAAAAAACAGATGCGCCCCATCCTCGTCGAGCCTGTTGCACATACTGCACAAAGTATCAGTCTTCACCCCCCTTCGTTTCA
ACATCCTTTTGACAGCTAGAGTATTGTGACTCATCCTCCATAAGAAATGTTTCACTTTCGGTGGGCATTCCAGTTTCCATATTTTATTCCAGAAGTCTGCTCCTCCGGTGCTACTACCAG
TACCAGCCCTGTTCAGACATTTTTGTTCTCTGAACTCGCAGTTTCTCTGAACTTTATACGCTGACTTAACGGAGAATTGTCCTTTCGCATCAAAATGCCATCCAACAACATCATCCATCT
CCTGGTGTACTGGTATGGATCCATTCATTTGGACATCCTCCTCTGTAAAGATTTGCTGCAGCAGAGAAATGTCCCAATGTTCTGTAATCGGGTCTATAAGCTCATCCACCTTTTTCAGCT
CGTTCAAGTATAGGAAGTTGAGCTTCGTATACACTCGCCTCACATAGTCACATATTCATGTGCTAAACACCAAAAGATGCTACATGCTGTAGGGAATATACGCACTGAACGAGATATTAG
TATGATATATATAAGCAGACAAATTGTTCAGAATTGGACAGATAAATAAACGTTTGTACATATTTTTGAAGTACCATACACTGTTTTTTTCTATTTTGGCCTGAGAACGGGCTGACAATT
TTGGCCTATACAAATATTAAGGCCTGAAAAAAATAGAATCAGATTATGAAATGGCCCGTGGGATATGATGTGGCCCATTGCCATCCTCAGATGCAGATGTAGCAAGTCCTATGAATGTTT
ATTAGCTTTGGTTTTTTGAATTAAAAGATCACTTGTCTGTAATGATTATTACAGTGGCCTGACCAATTCTAACTACACGGAGCTTACCCAGCTATACGAGATGTACAAGGACCAGGGTGA
GTCGCATTTATTTGAGATACTGAATTTCTCTCTCTGTTTTTTTGATGCCCAGTTCCTCATGTCGTAGATTGGTTCAGTTATGATTCATAGTATGCTATAAATTAATATTGCTGTAATTGG
TGTGACCTTCTTCAGGTTTTGAGATCCTTGCGTTCCCATGCAACCAGTTCGGTGGGCAAGAGCCTGCCACGAGTGAGGAGATCGTCCAGTTTGTTTGCACTCGCTTCACGGCCAAGTTTC
CAATTTTTGACAAG
GTAATAAATTTGTGCGCACAAAACTTCTTCAATTTCTACTCTTTTGCATGTCCAACCTGAAATGAACAGCGACTGATCATCATGTAGGAGTAATTCTAAGGTTACA
AAGTTTTAACACTTTTCCTTTATTTTTCCCCGTAAGGTTGACGTCAACGGCGAAGATGCTGCACCCATCTACAAGTTTCTGAAATCCAGCAAAACCGGTCCCTTCGGTGAGAACATCAAG
TGGAACTTCGCCAAGTTCTTGGTTGACAAAAAGGGGCATGTCATTGAGCGGTATGCTCCAACCACTTACCCACTCAGCATCCAG
GTGAGAGTTCGGACTGGTGCATCTTGTGCTATACAT
ACTCGTCGAACTTCCTCGATCGTCTGATCTTACAAGACTACCTTTATTTTGCATATCTGCAGAAGGACATCAAGAAGCTGCTTGGGAGTTATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCCGCCAGCTCCCTCCACGACTTCATCGTCAAGGATGCAAGCGGCAAAGATGTGCACCTGAGCACCTACAAGGGCAAGGTTCTCCTCATCGTCAACGTTGCATCAAAGTGTGGC
CTGACCAATTCTAACTACACGGAGCTTACCCAGCTATACGAGATGTACAAGGACCAGG
GTTTTGAGATCCTTGCGTTCCCATGCAACCAGTTCGGTGGGCAAGAGCCTGCCACGAGTGAG
GAGATCGTCCAGTTTGTTTGCACTCGCTTCACGGCCAAGTTTCCAATTTTTGACAAG
GTTGACGTCAACGGCGAAGATGCTGCACCCATCTACAAGTTTCTGAAATCCAGCAAAACCGGT
CCCTTCGGTGAGAACATCAAGTGGAACTTCGCCAAGTTCTTGGTTGACAAAAAGGGGCATGTCATTGAGCGGTATGCTCCAACCACTTACCCACTCAGCATCCAG
AAGGACATCAAGAAG
CTGCTTGGGAGTTATTGA

Retrieve as FASTA