Entry information : ZmPrx144
Entry ID 7939
Creation 2011-01-25 (Christophe Dunand)
Last sequence changes 2011-01-25 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-09 (Qiang Li)
Peroxidase information: ZmPrx144
Name ZmPrx144
Class Class III peroxidase    [Orthogroup: Prx092]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx144
start..stop
S start..stop
ZmPrx145 663 0 1..337 1..336
SbPrx15 598 0 2..337 3..332
SiPrx155 544 0 1..337 1..320
ZmPrx[P]110 541 0 1..279 1..278
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 63847134..63847385 252 N° 2 63847531..63848292 762  
join(63847134..63847385,63847531..63848292)


exon

Literature and cross-references ZmPrx144
Protein sequence: ZmPrx144
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   337 (310)
PWM (Da):   %s   35170.69 (32628.4) Transmb domain:   %s   i7-29o
PI (pH):   %s   7.03 (6.76) Peptide Signal:   %s   cut: 28 range:28-337
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASKVPAALLSCAFLLLLGAACQAAAGHYSPPSPASCGLKVGYYDHKCPPAEAIVKSVVRAAVRRNPGIGAGLIRMLFHDCFVEGCDASVLLDPTPANPQPEKLGPPNNPSLRGFEVIDAAKAAVERACPGVVSCADIVAFAARDASSFLGGRRVDFDMPAGRLDGRASNASRTLDFLPPPTSSLPELVQSFAAKGLSAEDMVALSGAHTVGRSHCSSFVPDRLAVPSDISASFAASLKGQCPASPSSSDDPTVVQDVVTPDRLDNQYYKNVLAHRVLFTSDASLLTSPATAKLVDDNANVPGWWEDSFKVAMVKMASVEVKTGNSGEIRRNCRLVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, intron 1). No EST. No prediction from Phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGCAAGGTGCCTGCTGCACTGCTCTCATGTGCTTTCTTGCTCCTACTAGGAGCCGCATGCCAAGCAGCAGCTGGTCACTACAGTCCTCCGAGTCCTGCTTCGTGCGGGCTCAAG
GTGGGGTACTACGACCACAAGTGTCCGCCTGCCGAGGCCATCGTCAAGAGCGTCGTCAGAGCCGCCGTCCGGCGGAACCCCGGCATCGGCGCCGGCCTCATCCGCATGCTCTTCCACGAC
TGCTTCGTCGAG
GTACATACATTTCCTCTTCTTCTCGTCAGCTCTACTTCTACACGCATTGCTTTTTTTAGCTATAGTACCATGCATGAGATGCCGTCGTCTTCACTGATGACGCAACGC
GCGCCCACGCCCACCCATGCTATATATACACGCGCAGGGCTGCGACGCCTCCGTGCTGCTGGACCCGACGCCGGCCAACCCGCAGCCGGAGAAGCTCGGCCCGCCCAACAACCCCAGCCT
CCGGGGCTTCGAGGTCATCGACGCCGCCAAGGCCGCGGTGGAGCGGGCGTGCCCGGGCGTCGTCTCGTGCGCGGACATCGTCGCCTTCGCCGCCCGCGACGCCTCCTCCTTCCTCGGCGG
CCGCCGGGTCGACTTCGACATGCCCGCCGGCCGCCTCGACGGCCGCGCCTCCAACGCCTCGCGCACGCTCGACTTCCTCCCGCCGCCGACCTCCAGCCTCCCCGAGCTCGTCCAGAGCTT
CGCCGCCAAGGGCCTCTCCGCCGAGGACATGGTCGCGCTCTCGGGCGCGCACACCGTCGGCCGGTCCCACTGCTCGTCCTTCGTCCCCGACCGCCTCGCAGTGCCCTCCGACATCAGCGC
CTCCTTCGCCGCGTCCCTGAAGGGACAGTGCCCCGCGAGCCCCAGCTCCAGCGACGACCCTACCGTCGTGCAGGACGTCGTGACGCCGGACAGGCTGGACAACCAGTATTACAAGAACGT
GCTGGCGCACAGAGTCCTCTTCACGTCGGACGCCTCACTCCTCACGTCGCCGGCGACGGCGAAGCTGGTGGATGACAACGCCAACGTCCCCGGGTGGTGGGAGGACAGCTTCAAGGTGGC
CATGGTGAAGATGGCCAGTGTCGAGGTGAAGACCGGCAACAGCGGCGAGATCAGGAGGAACTGCCGTCTCGTCAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGCAAGGTGCCTGCTGCACTGCTCTCATGTGCTTTCTTGCTCCTACTAGGAGCCGCATGCCAAGCAGCAGCTGGTCACTACAGTCCTCCGAGTCCTGCTTCGTGCGGGCTCAAG
GTGGGGTACTACGACCACAAGTGTCCGCCTGCCGAGGCCATCGTCAAGAGCGTCGTCAGAGCCGCCGTCCGGCGGAACCCCGGCATCGGCGCCGGCCTCATCCGCATGCTCTTCCACGAC
TGCTTCGTCGAG
GGCTGCGACGCCTCCGTGCTGCTGGACCCGACGCCGGCCAACCCGCAGCCGGAGAAGCTCGGCCCGCCCAACAACCCCAGCCTCCGGGGCTTCGAGGTCATCGACGCC
GCCAAGGCCGCGGTGGAGCGGGCGTGCCCGGGCGTCGTCTCGTGCGCGGACATCGTCGCCTTCGCCGCCCGCGACGCCTCCTCCTTCCTCGGCGGCCGCCGGGTCGACTTCGACATGCCC
GCCGGCCGCCTCGACGGCCGCGCCTCCAACGCCTCGCGCACGCTCGACTTCCTCCCGCCGCCGACCTCCAGCCTCCCCGAGCTCGTCCAGAGCTTCGCCGCCAAGGGCCTCTCCGCCGAG
GACATGGTCGCGCTCTCGGGCGCGCACACCGTCGGCCGGTCCCACTGCTCGTCCTTCGTCCCCGACCGCCTCGCAGTGCCCTCCGACATCAGCGCCTCCTTCGCCGCGTCCCTGAAGGGA
CAGTGCCCCGCGAGCCCCAGCTCCAGCGACGACCCTACCGTCGTGCAGGACGTCGTGACGCCGGACAGGCTGGACAACCAGTATTACAAGAACGTGCTGGCGCACAGAGTCCTCTTCACG
TCGGACGCCTCACTCCTCACGTCGCCGGCGACGGCGAAGCTGGTGGATGACAACGCCAACGTCCCCGGGTGGTGGGAGGACAGCTTCAAGGTGGCCATGGTGAAGATGGCCAGTGTCGAG
GTGAAGACCGGCAACAGCGGCGAGATCAGGAGGAACTGCCGTCTCGTCAACTAG

Retrieve as FASTA