Entry information : ZmPrx145 (GRMZM2G168073)
Entry ID 7940
Creation 2011-01-25 (Christophe Dunand)
Last sequence changes 2011-01-25 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-11-28 (Qiang Li)
Peroxidase information: ZmPrx145 (GRMZM2G168073)
Name (synonym) ZmPrx145 (GRMZM2G168073)
Class Class III peroxidase    [Orthogroup: Prx092]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type Seedlings
Inducer Salt stress
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx145
start..stop
S start..stop
ZmPrx144 639 0 1..336 1..337
SbPrx15 605 0 2..336 3..332
ZmPrx[P]110 548 0 1..278 1..278
SiPrx155 547 0 1..336 1..320
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 63743565..63743813 249 N° 2 63743959..63744720 762  
join(63743565..63743813,63743959..63744720)


exon

Literature and cross-references ZmPrx145 (GRMZM2G168073)
EST ref. GenBank:   AI649415.1 [Fragment]
Protein sequence: ZmPrx145 (GRMZM2G168073)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336 (310)
PWM (Da):   %s   35160.69 (32627.4) Transmb domain:   %s   i7-29o
PI (pH):   %s   7.36 (7.05) Peptide Signal:   %s   cut: 27 range:27-336
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASKMPAALLSCAFLLLGAVFQAAAGHYSPPSPASCGLKVGYYDHKCPPAEAIVKSVVRAAVRRNPGIGAGLIRMLFHDCFVEGCDASVLLDPTPANPQPEKLGPPNNPSLRGFEVIDAAKAAVERACPGVVSCADIVAFAARDASSFLGGRRVDFDMPAGRLDGRASNASRTLDFLPPPTSSLPELVQSFAAKGLSAEDMVALSGAHTVGRSHCSSFVPDRLAVPSDISASFAASLRGQCPASPSSSNDPTVVQDVVTPDKLDNQYYKNVLAHRVLFTSDASLLTSPATAKLVDDNANVPGWWEDSFKVAMVKMASVEVKTGNSGEIRRNCRLVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, intron 1) and 1 EST. Incorrect prediction from Phytozome (exon 1 is not predicted). Cultivar="B73".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGCAAGATGCCTGCTGCACTGCTCTCATGTGCTTTCTTGCTCCTAGGAGCCGTATTCCAAGCAGCAGCTGGTCACTACAGTCCTCCGAGTCCTGCTTCGTGCGGACTCAAGGTG
GGGTACTACGATCACAAGTGTCCGCCTGCCGAGGCCATCGTCAAGAGCGTCGTCAGAGCCGCCGTCCGGCGGAACCCCGGCATCGGCGCCGGCCTCATCCGCATGCTCTTCCACGACTGC
TTCGTCGAG
GTACATACATTTCCTCTTCTTCTCGTCAGCTCTACTTCTACACGTACGCATTGCTTTTTTTTTTAGCTAGTACCATGCATGAGATGTCGTCGTCTTCACTGACGCCACGCG
CGCCCACGCCGCAATGCTATATATACACGCGCAGGGCTGCGACGCCTCCGTGCTGCTGGACCCGACGCCGGCCAACCCGCAGCCGGAGAAGCTCGGCCCGCCCAACAACCCCAGCCTCCG
GGGCTTCGAGGTCATCGACGCCGCCAAGGCCGCGGTGGAGCGGGCGTGCCCGGGCGTCGTCTCGTGCGCGGACATCGTCGCCTTCGCCGCCCGCGACGCCTCCTCCTTCCTCGGCGGCCG
CCGGGTCGACTTCGACATGCCCGCCGGCCGCCTCGACGGCCGCGCCTCCAACGCCTCGCGCACGCTCGACTTCCTCCCGCCCCCGACATCCAGCCTCCCCGAGCTCGTCCAGAGCTTCGC
CGCCAAGGGCCTCTCCGCCGAGGACATGGTCGCGCTCTCGGGCGCGCACACCGTCGGCCGGTCCCACTGCTCGTCCTTCGTCCCCGACCGCCTCGCAGTGCCCTCCGACATCAGCGCCTC
CTTCGCCGCGTCCCTGAGGGGCCAGTGCCCCGCGAGCCCCAGCTCCAGCAACGACCCTACCGTCGTGCAGGACGTCGTGACACCGGACAAGCTGGACAACCAGTATTACAAGAATGTGCT
GGCGCACAGAGTCCTCTTCACGTCGGACGCCTCACTCCTCACGTCGCCGGCGACGGCGAAGCTGGTGGATGACAACGCCAACGTCCCCGGATGGTGGGAGGACAGCTTCAAGGTGGCCAT
GGTGAAGATGGCCAGTGTCGAGGTGAAGACCGGCAACAGCGGCGAGATCAGGAGGAACTGCCGTCTTGTCAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGCAAGATGCCTGCTGCACTGCTCTCATGTGCTTTCTTGCTCCTAGGAGCCGTATTCCAAGCAGCAGCTGGTCACTACAGTCCTCCGAGTCCTGCTTCGTGCGGACTCAAGGTG
GGGTACTACGATCACAAGTGTCCGCCTGCCGAGGCCATCGTCAAGAGCGTCGTCAGAGCCGCCGTCCGGCGGAACCCCGGCATCGGCGCCGGCCTCATCCGCATGCTCTTCCACGACTGC
TTCGTCGAG
GGCTGCGACGCCTCCGTGCTGCTGGACCCGACGCCGGCCAACCCGCAGCCGGAGAAGCTCGGCCCGCCCAACAACCCCAGCCTCCGGGGCTTCGAGGTCATCGACGCCGCC
AAGGCCGCGGTGGAGCGGGCGTGCCCGGGCGTCGTCTCGTGCGCGGACATCGTCGCCTTCGCCGCCCGCGACGCCTCCTCCTTCCTCGGCGGCCGCCGGGTCGACTTCGACATGCCCGCC
GGCCGCCTCGACGGCCGCGCCTCCAACGCCTCGCGCACGCTCGACTTCCTCCCGCCCCCGACATCCAGCCTCCCCGAGCTCGTCCAGAGCTTCGCCGCCAAGGGCCTCTCCGCCGAGGAC
ATGGTCGCGCTCTCGGGCGCGCACACCGTCGGCCGGTCCCACTGCTCGTCCTTCGTCCCCGACCGCCTCGCAGTGCCCTCCGACATCAGCGCCTCCTTCGCCGCGTCCCTGAGGGGCCAG
TGCCCCGCGAGCCCCAGCTCCAGCAACGACCCTACCGTCGTGCAGGACGTCGTGACACCGGACAAGCTGGACAACCAGTATTACAAGAATGTGCTGGCGCACAGAGTCCTCTTCACGTCG
GACGCCTCACTCCTCACGTCGCCGGCGACGGCGAAGCTGGTGGATGACAACGCCAACGTCCCCGGATGGTGGGAGGACAGCTTCAAGGTGGCCATGGTGAAGATGGCCAGTGTCGAGGTG
AAGACCGGCAACAGCGGCGAGATCAGGAGGAACTGCCGTCTTGTCAACTAG

Retrieve as FASTA