Entry information : PpaPrx[P]06
Entry ID 7968
Creation 2011-02-02 (Toky Ramarohetra)
Last sequence changes 2012-01-05 (Toky Ramarohetra)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-07-03 (Qiang Li)
Peroxidase information: PpaPrx[P]06
Name PpaPrx[P]06
Class Class III peroxidase     [Orthogroup: Prx040]*
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaPrx[P]06
start..stop
S start..stop
PpaPrx52 436 7e-156 1..279 1..280
PpaPrx06 436 7e-156 1..279 1..280
PpaPrx36 315 2e-108 30..279 31..281
PpaPrx02 296 9e-101 1..278 1..280
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 257005..257220 216 N° 2 256045..256665 621  
complement(join(256045..256665,257005..257220))


exon

Literature and cross-references PpaPrx[P]06
DNA ref. Phytozome 12:   scaffold_260 (257220..256045)
Protein sequence: PpaPrx[P]06
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   276 (250)
PWM (Da):   %s   29909.16 (27202.7) Transmb domain:   %s   o10-32i
PI (pH):   %s   6.49 (5.62) Peptide Signal:   %s   cut: 27 range:27-276
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAHKKMRSSLVALVLVVALVMSGVDATVRYGFYDHSCPNAKQIVFKEIQKAYEKNTVALGILRLIFHDCFVRGCDASILLAGNDTERAAVQNVGIHGFEAFDAAKAAV*EACPGVVSCADILAFASRDTVILTKGKGWEVPAGRMDGSVSNVSDPPLNLPPATFTSQELVSVFAS*GLTAQQMVDLSGCHTIGITQCIHLCDRIFTTIDPTMPKRILL*LQLKCPSNTSATPLQIDRYTCNLFDTQDFRNIVWGRGIMTSDQDLFRDPATRPFVEADLK

Retrieve as FASTA  
Remarks Pseudogene (In-frame stop codons).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCACAAGAAGATGAGGTCTTCTCTTGTAGCTTTAGTACTAGTCGTAGCACTGGTGATGAGTGGGGTAGATGCCACGGTGAGGTACGGCTTCTACGACCATTCGTGTCCCAATGCG
AAGCAAATCGTGTTCAAGGAAATTCAGAAAGCGTACGAGAAGAACACAGTTGCACTCGGAATTCTCCGTCTCATCTTCCATGACTGCTTCGTTCGG
GTACGTAGGCAACTGATCATTTCT
ATAACCTGTCGGTTGCTCTTGATACAATACTGTGCCGCGGCGCATTGCAAAGATTGAGCTTAAATTAGTTTTACATGTTTCAATCTTTTCGTACGTGGGGCGCATTTCGAATCATCGTGG
CTGCACAACATACATTGCAGCGGTAATAACCTGAATTCACATATGGGGATTAGGCTCATGAATCGAATTTTGTGAATCTTTCTGATACTAGTTAATACTGATATGTTTCATGTCTTTTTC
GATGGCGGACATCGAGTCAAGCCCGATTCAGAGAAAACTGTAACATTGCTTTAATGAATCTCTTGATGGCTGCAGGGCTGCGACGCCTCCATCCTGTTGGCAGGAAACGACACAGAGAGA
GCTGCCGTACAGAATGTCGGGATCCATGGCTTTGAAGCCTTCGACGCAGCCAAGGCCGCCGTCTAGGAAGCCTGTCCTGGAGTGGTATCATGCGCTGACATCCTCGCATTCGCTTCTCGC
GACACCGTGATCTTGACCAAAGGAAAAGGCTGGGAGGTCCCCGCGGGACGTATGGACGGCAGCGTCTCGAATGTTTCGGATCCCCCGCTGAACCTGCCTCCTGCTACCTTCACGAGCCAG
GAGCTCGTAAGTGTCTTTGCTTCTTAGGGTCTAACCGCTCAGCAGATGGTCGACCTCTCCGGTTGTCACACCATCGGAATCACCCAATGCATCCACCTGTGCGACAGGATCTTCACCACC
ATCGACCCCACCATGCCAAAGAGGATCCTTCTCTAACTGCAGCTCAAGTGCCCTTCCAACACCTCCGCCACTCCACTGCAGATCGACCGCTACACGTGCAACCTTTTCGACACCCAGGAC
TTCAGGAACATCGTCTGGGGCCGCGGCATAATGACCTCCGACCAAGATCTATTCAGGGACCCTGCAACGCGACCCTTTGTGGAGGCTGATCTGAAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCACAAGAAGATGAGGTCTTCTCTTGTAGCTTTAGTACTAGTCGTAGCACTGGTGATGAGTGGGGTAGATGCCACGGTGAGGTACGGCTTCTACGACCATTCGTGTCCCAATGCG
AAGCAAATCGTGTTCAAGGAAATTCAGAAAGCGTACGAGAAGAACACAGTTGCACTCGGAATTCTCCGTCTCATCTTCCATGACTGCTTCGTTCGG
GGCTGCGACGCCTCCATCCTGTTG
GCAGGAAACGACACAGAGAGAGCTGCCGTACAGAATGTCGGGATCCATGGCTTTGAAGCCTTCGACGCAGCCAAGGCCGCCGTCTAGGAAGCCTGTCCTGGAGTGGTATCATGCGCTGAC
ATCCTCGCATTCGCTTCTCGCGACACCGTGATCTTGACCAAAGGAAAAGGCTGGGAGGTCCCCGCGGGACGTATGGACGGCAGCGTCTCGAATGTTTCGGATCCCCCGCTGAACCTGCCT
CCTGCTACCTTCACGAGCCAGGAGCTCGTAAGTGTCTTTGCTTCTTAGGGTCTAACCGCTCAGCAGATGGTCGACCTCTCCGGTTGTCACACCATCGGAATCACCCAATGCATCCACCTG
TGCGACAGGATCTTCACCACCATCGACCCCACCATGCCAAAGAGGATCCTTCTCTAACTGCAGCTCAAGTGCCCTTCCAACACCTCCGCCACTCCACTGCAGATCGACCGCTACACGTGC
AACCTTTTCGACACCCAGGACTTCAGGAACATCGTCTGGGGCCGCGGCATAATGACCTCCGACCAAGATCTATTCAGGGACCCTGCAACGCGACCCTTTGTGGAGGCTGATCTGAAG

Retrieve as FASTA