Entry information : AImeTPO
Entry ID 7974
Creation 2011-02-03 (Christophe Dunand)
Last sequence changes 2011-02-10 (Catherine Mathe)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-08-11 (Christophe Dunand)
Peroxidase information: AImeTPO
Name AImeTPO
Class Thyroid peroxidase    [Orthogroup: TPO001]
Taxonomy Eukaryota Metazoa Chordata Mammalia Ursidae Ailuropoda
Organism Ailuropoda melanoleuca (Giant panda)    [TaxId: 9646 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AImeTPO
start..stop
S start..stop
CfaTPO 1575 0 1..934 1..926
HsTPO01 1358 0 1..891 1..889
MmTPO 1355 0 1..898 1..881
GgoTPO 1351 0 1..891 1..887
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..94 94 N° 2 6712..6796 85 N° 3 15160..15335 176 N° 4 17056..17188 133
N° 5 22714..22843 130 N° 6 24477..24683 207 N° 7 26170..26688 519 N° 8 30077..30335 259
N° 9 31508..31678 171 N° 10 32718..32955 238 N° 11 33503..33711 209 N° 12 34403..34573 171
N° 13 39121..39252 132 N° 14 42136..42235 100 N° 15 47851..47982 132 N° 16 48953..49025 73
join(1..94,6712..6796,15160..15335,17056..17188,22714..22843,24477..24683,26170. .26688,30077..30335,31508..31678,32718..32955,33503..33711,34403..34573,39121..3 9252,42136..42235,47851..47982,48953..49025)


exon

Literature and cross-references AImeTPO
DNA ref. GenBank:   NW_003217834.1 (30456..79478)
Protein sequence: AImeTPO
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   943
PWM (Da):   %s   102137.3 Transmb domain:   %s   i2-24o851-873i
PI (pH):   %s   7.96
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRVLAVLGVTLVAACTHGFLPFFLRGKDLLWGRDGDSPVISVVEESRRMVDSAIYHTMRRDLSKREIPSPSRLLSFSKLPEPTSRAVSRAAEIMEASVRALKTRVYGKXXXHPPVSPDVLPEDVLNTIANVSGCLPYMLPPGCPNTCLASKYRLITGACNSRDHPRWGAANTALARWLPPAYEDGVSEPRGWNPHFLYNGFPLPVREVTRQVIQVPNEAVTEDDQYSDLLMVWGQYIDHDIAFTPQTTSKAAFGGGADCQLTCENQNPCFPIQLPANASGTAGGACLPFYRSSAACGTGIQGAFFGNVTSANPRQQMNGLTSFLDASTVYGSSPALEKQLRNWTSAEGLLRVNTRHWDAGRAYLPFTRPPAPTACVPEPGTHGTAGAPCFLAGDGRASEVPALTAVHTLWLREHNRLASALKALNAHWSADTAYQEARKVVGALHQIITMRDYVPKVLGPEAFQQHVGPYGGYDPGVDPTVSNVFSTAAFRFGHATVHPLVRRLDARFQEHPALPPLRLQDAFFSPWRLLKEGGVDPLVRGLLARPAKLQVQDQLMNEELTERLFVLGSSGRLDLASINLQRGRDHGLPGYNAWREFCGLPRLETRADLRSAVTNASIAGRIMDLYGHPDNIDVWLGGLAETFLPQARTGPLFACLIGKQMKALRDGDRFWWESSGVFTEAQRRELARHSLSRVICDNTGLPSVPADAFQIGRFPQDFESCENIPGLNLDMWREALPGDACSLPDGVDNGGVTLCGESGQHVLVFFCHHGFQLQGQEQVACSPRGADLRPPVCRDINECEDVTPPPCHPSARCRNTKGSFRCECTDPYVLGEDGTTCVDSGRLPKASLVSIALGALLVGGLAGLTWTVICRWTHAGRKASLHIRDTGGRGTCQPGRGTRRDMSVSSLVPLLGAQGRTRPVDPKSFSASRSHSGARGSWA

Retrieve as FASTA  
Remarks Complete sequence from genomic. No EST. C deleted in genomic sequence (and CDS) in exon 15.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGTGCTCGCGGTCCTGGGCGTCACGCTGGTGGCGGCCTGCACACATGGCTTCTTGCCCTTCTTCCTGAGAGGCAAGGACCTCCTGTGGGGTGAGTAACCAATAAATATCGTCTCT
GGCCTCATGAAGCCACTGCCCGCAGCCGCGGAAGCCGAGCAGCGTGGCGGCTGCTGAGAGTCAGGGGCAACTCGTTCCGTGTTCCCTCCTGCGTTCCCAAGAAGGGAGCGGTGGTTCTGG
CGGGCGGAGGGATCGACACACGCCTGTCTGAAGAGTAACTCACGTCCTATGACTGTTAATGACACTCTCCCTTTTACCTGCTTGAGTATTTGAAAAAAAATGTCTTTGGGAGAAGTTGCT
TATGCCTTTGCTATGAAAACAGTTTCTGTGAAGGGTGTGCGTTCCGGAATCAGGTGCTACAGTGTCGGGCGGGGTTGAGAAAGGGTTGGGGTTGTTAAAATGATCACAGCTCAAACTCTG
CTTTTGTTTGGCTAAAAAAGAAGCAAGAAGAGGCACCTTGAAGGGATTTGACTCGAGCACAATGTTGGTGGTGCCTCTGGCTGCCGGCCCGGGGACACAGACCGCCCCCAGCAGGCTCCT
GCCTCCCTGCAGCCTGGCGAGGCTTTCTGCGGATCCGGGCCCTTCACACCTTTCTCGGGAGTGGGAGGACCCTCATGCTGACAGCCCCCGCCCCACCTCCTGCTGGAACCCCCACTTTTC
CCAATCCTGTGGAACTTGGGGGCTTCGTGACAATGTGGAAAGTTGCACTGATGTCCATCACAGACTCCTCTGCCCCCTGAGAAAGCGCCCAGCACATCCCAGGCAGCAGGAAGCTGGAGG
CAAGCGCTGGGCACAGAGAACACCAGCCTGCACCTGTCCGGCTTTGCACACGCTCCTTCCCTTGATACACCTGCCACACACAGGACACAGGGAATCGCCCGTCACGGTGACCCCTGATGT
GCCGCCCCGTGTTGAGTGCACTGCGTCTGGACGACACCAGGAAACAAAATCAGACGCACATTTCAGCACGCCTGGGGGGAAGGTGGTCTCATCTCGCCCCCGTGAGCCAACCGTCCCAGT
GCCCGGGATGTTGAGCAAGTGTCTTGTGAATTAGTTAATTTGTCCTTTTATTTCATACTTATTAAGACCCTGGTCCTTAAAACCATGGTAACAAAAGTCAGGAGTCCCTTGGCTCATCGT
GACGAAGTCATGCCGTCCGCCGGCGCATCAAGCCCACCGGCAGCACGTTGTTGGCTCAGGAATCGTAGCCGACAAATCGGGACGTGCGATCTCTGCAGTGTCGCTAGAGCAAAACTTTAT
CACTGCCCTGTCGGAGAGTTTGGTTTTCTTTTTGCTGAAACTTGGAATAAGCACATAAATCATGTACCATGCAGCATCTGACCAGAATGCTGAACGTTGGGGGTATTTTATTGTCAGTTG
GAATATTTTGCGGTCAGCTTATGAATAGTTTACAAATTACTTTTTTAGAAAATATTTCTCTCGTTGGGTCTGACTTTACATTCATTAACATAAGAGATTGTTTTTCCCAGTTGACGAGCT
AACAGCAACTTTCACTGGTAAACCTTTGGAAGATCCTTGTTACTGGTCACATTTCACGGTCTCCGATTTAAGTCATGAGACTGGTTGGTGTTTTCCTGGGTTTGCGTTCTTATCACAGGA
CTGGGGTCTTTAGACTGGATGCGCCGGGGAGAGGTGTCCAGCCTGGCTGCCTGGAGGTGGGCTGCCTGCGGGCTCGCAGCTGGGCATCTCTCCCCAGTGCGTCCAGTCTACTCATGGCCC
CGGGAGGGCCCCAGAGACCCACGTCCAGTGTCTAGTCACCCCTGGGAGGGCCCCAGAGGCCTGAGTCCAGGGTCCGGTCACTCTCAGGAGGGCCCCAGAGGCCCAATCATGTCCAGTTGC
CCCCGGGGAGGACCCCAGAGGCCCGCACCCAGTGTCTGGTTGCCCCCAGGGGGCCCCCAGAGGCCCAAGGTGCAGCTGTGTCCACGCTTAGTGTCCTTCCAGGTCCTTCCGTGGAAGCTC
TGCACACAGGACTGAAGACCGGCTGATACACAGTCAAGGACACGTGTAGGTCCTGGACACGCATACCTGAGGGTCAGGCTGTGGCCTGTAGCAGTTTGGGGGGCGGGAGCGAGGCCAGGG
GACCCTTGCACTTACCCTTGTCTGACTCAGGAAAAGCCCCAGAGTAGGACCCAGGAGGGGTTAGCTCAGAGAGGAGTAAACTGAGGCACCTGAACTTTCTGTGTAAGAATGAGTTGGCAG
TGGAGGGAGATCTCATTTTTGCTCCGAAATGCCCACATGGCCTTGTGGGTCTAAGAGAGAAGGCTGAGCCCCTTCTGCAGAGCCTGAGGAGGGCCTCATGGAAGCCGCGTCTTTGTCAGC
ACGGAGGGGATGCGTGTCCACTGTTTGTGCAAAGTTGAGATTGATGCACAAGCATGTTTATGGGAGATGCTCCCACAAGTTAGAGCTGCTACAGACAATGAGATGCGAACGAAGAGCGGG
AAGCGGAGACCCTGCCGGCAGATCGGGAGATTCGGGATCCGGCGTCGTGAGGGAGCGTGCTGAACGAGGAAAGTTGGCAAACTTTGTTCCAGTCGTTTGGGTTTCGGCAAAGAGAGATAA
GGAACGTCAGGATCCAAACACAGAGCTCTGAGCAAGACCAGCTCCACAAAGTCAGTCAGTGGTGACGCCTGCGGGCCCCGCATGGTTTCCGGCTTCAGAGAAGGAGTATCTCGCCATTCT
TGTTATTAAGTTTTTTAACAAGCGCTCTCTGGGAATGGTTGACTTGCCGCTTCTTCCTGAATCATGGTGTCCACTCGCATAATGGCTTCGCAGGCTCCAGCCCTCCGACACCTGAGATGA
TTATGTCCCGGGGAGAACTTTCTTGGGGGGACTGGGACCGTCTTCAGAAGGCTGGTGACTTCAGATTGGACAAGTCATGGAACTCTCCAGAAGTCAGTGTTCAGAGCTGAGAAGAAGAGG
GCAGGTTTAGAATCGCGAGGTCTGTGGTGCTGACCGAGCCGCCGCATGAGGCTGACCAGCCCTGGAGGGAGGAGCTAAGGTGGAGAAGGGGGTGCAGGGTTCCTGAAGGAAGAGCAAGCC
CGCCGTCCTGTGTAGGACAGAAGAAACCGAGCAGTCGTCATCTGCACTGTGGGGATTTATAGGACACACACAGTCCTTTCGACACCAGAATGGATTTCTCCCCCTTTCTTGCTCACAGGT
CCCTAAACACTAGTGGTTTCCTGTGATAGTGGCAGGCCTTAAAGATGCCTTTGTTATGTAAATAAGGAGACTTTGGAAAGCCCTTAGGTCACCCAGGGATGGGAGCTGGTGGCCAAGAGC
ACCAACCATGTGATTGGAGGGTCAGAATTTTCCAGGCCCCCAACCTGGCATCTGGGCAAGGGGAGGGGCTGGACGGTGAATCAGGCGCCAGTGGCCAGGGACTTCGCCACTGTGCCTCTG
TGATGAAGCCTCCAAAAGAACCCAGAAGCACTGGGTTTGGAAAGCTGCCAGGTTGGGGAATCCGAACGTTCCCGCGTGCACTGAGCTGGCCCCGTGCGTCACGGGCACAGACGCGTGTTT
GTTGCAGGGCCTCACCCTACACGTCTCTCCTTCTGGCTGTTGATTTGCATCCGTGAATAAACTGATCAATGAAAGCTCCATGAGCCCCCCAGCAAATTAAGGGAGCTGAGGAGGAGGTCC
TCGGAACCGCCTCGGTGTAGACTTTGGCCAGAAGCGCAGGTGTCGGCCTGGGGCTTCGACCAGCGTCCTGTGGGCCTGAGTCCGCACCCCGTGGGGTGTGGTGCCACCTCGGGGTGGGTT
GTGCTCGGACTGAGTGCAGTTCTCAGCCAGCCGGTCGGCGTCTGACAATTGTGTTGTGTGCGGGGAACCCCCTCCCACGCCGGAATTGGGTCCCGGGACCCAAAAGCCCACCGACCCAGT
TCCCGCAGGCACTGGAGACGATCACAGCTGAGAAGAACACTTTTCTGGGTGAAGGTTTTCAACACCAAAATATGTTTCATATACAAAATATGAAGAGAATAATCTGCAAGCCTGTCACGC
TGACTCTAAAAATTCAGTAAAGCTTTGTAACGAGACTGGAGCACAGGCCGTACGCGATCAGAGTAGCTTCAATGACAACGTGTCGACGGCGATCAATAGTAAGAGACGATCGCCAGCAAT
GGCTGACCCCACAAGCTGCCGGTGGCGGCGGTTGACTTTTAGGACCAGCCACTGGCCTGAGTACTGAGAAGACACAAACACGGAGAAGCTGCAAGCCCTTAAGGAAATCATGCAGGCCGG
ACGTGCACACAGGTGGCAGGAATGAAGGCGCGAAATGCCTTTTCTGGTGCGCAAAAGCCACAGCGTCTCGTGGGGAGCAGCGGGTGAGCTGGAAATTGAGGCGGAACGGCTCCTAGGATG
AGAGGTGCCCTGAGACCAGAGGACAGGCTCCGGGCCAATTGTGAAGGTCTGGGGTCCGAGGGAGCCCGCACCGCGTTCTGCTATCCGTGGGGGTTCTCGGCTACCGCCCGGACGGCACAG
ACTGGAGCAGGACTTTGTTTAAGGAAGGTCGCTGGACGGTGAAGGCAGATCCAGGAAGGCACCGGCCACCGCGGTAGGAGGTGGTGACACGGGACAAGCCGTTTTCCAGGAGGTGTTAAG
AGGAAGTTAATACAATAAGGTGAAAGAAAGGGAAGAAAACCCGTTGCTGAGTTTGTCCTTGGGCCCCTGACTTGCTGGGTGACTGGGGACACCAGCACTTGTGGGGAACAGGAGAGCAGG
TCATGGGTTTGGGTTTCAGGAGAGGAGTTCCAGGCGGGGCTGGCCGCCTGGGAGAGGGTGATCAGAGGGCCACTCGCTGTGGCTGAGAGCGCCGGAGACGGGAGCAGAAGAGCCGCTGCT
TCCAACGCTCGGGTTTGTGGGGTCCTCTGCTGAGAGCTTCAGAAATCACTGGTTTCACCCTCGAAATAATCCTCCAGGTGATCAGAAGTGAGAAACCGGGTGGGGAACCAGTTTCAGAGG
GGGCTCCAAGGTGTCACCATGGGGCGCAGGGTCAAGCGAGCAGGGCGACTGTTGCATTCGGCAAGTAAGGGGCCGTGCTGGCTTTGGGGATGAGGATGTGAGCCGCGAGAGCCATTAAGT
GGGTTTGGAGGGGAATCGCAGGTGCACTGTGCCCCTGCTTTCGTGGGCTCGCCCCTGGCCCTGCAGGTCCCAGAGAGACTCCCACAAGCCCAGCTTGGTCCTTGGAGCCCCTGCCTGTTC
TGCGGGTTTGTGCCTCCTTCCCGCTGGCCCCTTACTCACATTCCACAGCGAGAACCTCTGAGCTCGCCAGTCGGGGCCCCGCCAGAGCGGCACCTGCTCCGTGGTGCGCTCCCCACAGAC
CCTCATGGACGGAGGGTCACCCAGCACTCGGTGGCTCATCGCTTCTCCCAGAATCCCAGGGACGATCCACGTGGAACTGTGTCTTTCTTCTGAAACACTCAGAGGAAACGGGGAGGCGCG
GGGGGCAGTGGAGAGTGTGTGTGCCGCTGGCTGAGCTGGGCTCTGACCGGCAGACCTGGGGAGTCTGCTGGGGTCTCCGGCTTCGGCACCTGCTGTCCCAGGCTCTGCACACCCTCCTCA
CAGTTTAGAGGCTCTGTTTCTTCCTGCAGCAAAATCATTAGTGACGTTTTAGGGAAAGGGCCACCTGCCAAGCGTACTCAGTACTTTAACAGATTTTCTGGGACGTGCTGTGCCCTCTTC
ATCCTGAATATAGACGTTTACTGTTCCAAAAAGAGGTGACTCTCTATAAAGGTGTATATGTTTGAAAACATTCTGGTAATCCATTTATTTTTACAAATAAATGCATTTCCTATTGATTAT
GCAAAAGATATGTTATAACAAACTACTTGCCTGCGTCACCTCATTCACTTGGAACCTCACAGTTTACCCCAGACACGGAATCGTACGAGATTTTTCTAGTCTGGGCTGCTCTAACAAACT
GGGTGGCATAGAAGCAGGAGACAGGCACTTCTCACGCTCTGGAGGCTGCAGGTCTGGACTAAGGAGCCGGCAGATTCGGTGTCTGGTGAGGCCGCTGGCAGACGCATCCCTGCATCCCCA
CCGGCAGCGGCGCTCGGCCATGTCTTATTCGGGTCCTAATCCCAGCGTGGGGGCTCCACCTGTGCCCGTCCTCACATTGTCACTCTGGGGGCTAGGCTTCAATATACGAATTTTGAGGGG
ACGTGAGCATTTAGAGCAGAGGACTTGTTAAACATTTCAAGCATGAAATAAAATGAGAGTCTTGTCATAGGAAACTGCTGGCATATTTAAGTAATTTATCTTTTGTTAATGCACAACTTA
AAATAGGGAAATATTATGAATGTACTGCGTCACTGGTTAGGGGACAAAGTACTCAGGGTCCTGTGGAATCGCCAGAGGTGGTCTGGGCAAGCGGGAAGCAAGAGTGACCAGACCGCGCTT
GGAGGCGATGCGAGTCTGTGGGTCCCTGTGCTCCTCGCGCTCCACGGGCAGTTCCGCTGGGGGAGCTCGTGCCCACCGTGAGGCGTGGAAACAAAGCCAGGACCCCACAGAGGGGGCCCA
GGAGCCGTGTGCTTGTCGCTGCCTCGCGCTGGGCTCGGTGGAGGACACTGAACGTGGCAGAGGGTGACTGCGCTCGAACCTGCCTCACTGTGCGGTAAATTGGTTCCACAGGACGGGACG
GAGACTCTCCTGTCATCAGCGTCGTGGAAGAGAGCAGGCGCATGGTGGACAGCGCCATCTACCATACCATGAGGAG
GTAGGCTTTCCGCGGGGGGCCGGGGGGCAGGGGCGGCACGGGTC
ACTAGGGGACGATGCCCGGGCTTGCCCGGTTTACTTGGCACCACGGGTCCAGCACCTCCCACTTGATGAATCAGGAGCTCACGTGCGTTCATTCATGTTCCTGGTTTCATGGGCAAGATC
CTGAAAAAACCGATATTCAGTCTCAAACTCTGTGTCTGGGGAAGCCCGGAGCGAAGCACGGTGATCCCGCCAGGACTCGGTACTGCGGTCCCAGCGGCGGGCGGGTGTCCCGGAGGCAGG
GGGCTCAGTAGGGAGGAGCCGCGCGACCAGAGCGGGGGCTGGGCGGGAGGACACCACGTCACATAGGGTGTTCAGTGCAGGATTAAGTCCACCCATCATTCTGGTTTAAGTCATTAAGAA
ACCCCTTGATTTTAAATATATAGTGATGGGTAGTATTGCATGGTGCACTGGGTGTTATACGCAACTAATGAATCATCAAACTTTACATTGGAAACCGGGGATGTACTGTGTGGTGACTAG
CATAATATAATAAAAAATATTTTTAAAAAATAAATATATATATAGTTGACATCAATATTGAGGCCACTGTGGTCTCACATGAGATGTTTGTAGAGCAAACAAACAGCTACAGAGCAGGTC
TCGTCCTCACAAGCTTGTTTCACTGGCAGCCAACTAATAATTGTATGATTATATAATACAATAATTATGTGAGCTCTCGCTAGGGACATGGCGTCCACATGCAGTCACGGCAGCCAGAGC
TGCAGCGTCCACGCGGCCCGAGACCCGGTCCCCAGAGCAAGGCACACCCCTTCCCTAGACGCCCGGATCCCCCACGGGCGTCCCTGCGCTCACGGACCCATGCTCTGTCTTCACAACGGA
CACAACCTTCACTCACTTGATGGGGAGCCTTCCAACGGGCCGCACAGCACTTGGTGTGACTGGTCTGGCTTTGCCCCCGCGGGCTCGGTGGCTATACGTGGGGCTCTGGCTCCAGACTCC
GCACCATTGCTGTGCTTGCTGGGGGTTTGTTCTCGCTTGGGATCGAGGGGGGTGCATTCACAGTCTTCCCATTAACTCCTGCTCTGACAGTTCTTCCCAATTTCCAATTCCAATTCCGTT
TAACTGTACCTATGATGGAGGCAGCATCCTGAAGTCACCGAGATGAGTCCTCCTAGTCCGGGGTCTGCTCTTCTAAAGCTCCCGCCCCTTCCCAGACACGCCACTGGCCATGGGGCGCAG
GAACTACACCATTGTAAGGGACGGTCTGTGTGCCTGCCGTTTGCCCTGGAGACAACGGCGTCCCTGTTACACAGGTGGTAGGACTGTTTTGCGGAGGAACACACTATCTCTGCCTTCCAA
CACTGCACCCTCTTTTTAAAGTAGCCTTCACGCCCAATGTGGGTCTTGAACTCAGGAGCCTGAGATCAAGAGTGGGGGCTCTGCTGAATAAGCCCGCCAGGCGCCCCTCAAAGCTGCCCC
TTTTCTAAGCATCCTTGTGAAGGTGGACGAGAACAAAGAACATCAGTTTCCTTTGTCTCACAAGATGTCGAGAAACAACCCAGAGCTCTGGAGAGTGTCCCACAACAAAATCTGCCCCCG
TGTGTACGCCACCCTGGCCTCTTGCAAAGTTTTCCACGACCCTGTACCTCCGGTGACCACTCCTGTGGACCTGTGTGGCAGGGCTGGGACCACATCCGTTATCCCACATCCCGTTCACTG
GGTTCAGCGGCTGCCCCCATGACTCCAGGCTGCAGGTGAGGCAGGCCCTGCTTACGGCATCCTCCCAGCTGCACAAACAGGTCCATCGAGTTCTCCCTCAGCAGACCTCTGCCCTTGGCC
AAGGCGTCACCGAGTGCGAGGGGAGGGTGTCTGCCATCTCAGGGCCCCCAACCCAACTGTCTCATCCACGGGTCTGCCAGCGAGCTGAGGCTGGCCTGAGTTTTCTTCCTCTGTTGAACT
CTGAGGACAAAGAAACGGGGCACTTGGGGCTTAACTGCCATTGTCAGGGCCATGGAGCTGCTGGCTCATAAGGAACAAAGGTGGACAAAGGAAGACATCACGTCTCAGTCCTGGTGAATC
TCATTGTACAGAATTCCCTACCTGGAACACCAAAAACATGGCCCCAAATTTGTTTTGCCCCTTTCTTTCATGGTAATGGTAAATGGAAATGCAAAAACGGGGAAACCAGTCACAGAGGAA
ACCAATCAGGAACATAATCGGTGAGGTCTTCTGAGGTGGTTTCTAGAAGCTTCTTCAAAAAATCTACCTGAGACCAGTGTCAAAAAAGAGGGAACTGAGGCTGCAAAGCAAAGTCAAAGG
GCCTTAGGCATTCGAATCCAGGAGATGCAGCCTCAGGAGGGCCCAGAAACATGCTCTGAGGGGAGGCAGCATTTATACGGGCGAAGCCACGAGCATCCGTGCTTTTTGGGAAGAACGCTG
ACCCGTGGAGGGGAAGTAACTGCCACGAGTCTACACAGGACGGGGCGGGGCCGGGCCGGTGCTCAGCGGGGGCTTGCAGGCCAGAGAAGTAAGCCTCATCTGAACCGCGTGGCGCGGGGT
GGCTGGCACCGCGAAGCTCATGCCCATCAGGGTCGGGGAGCCACCGACGCGCTCCCCCAGCAGCCTCCCTCGTGGCTCCACCGGGCCCTCGACACTCCTGACCTCAGGTCCAAGCCACTC
TTCCCGCTAGAAACGCCAAGGGCTTTTCCTCTTACGTGTAGTTGTTTCTCAATAGGATTAACGAACGAATGAGCCATTTGCTATTTGCTTACTAACCACAGAATGAATTACCACATTTCG
TTTTTTCTTAAAGATTTTGTTTATTTGACAGAGGACAGAGAGAGAGAGAAGGAGCAGGGGGAGGGGCAGAGGGAGAGAGAGAAGCAGGGTTTCCGCTGATCAAGGAGCCCGACGTGAGGC
TCCATCCAGACCCTGGGATCATGACCTGAGCCAAAGGCAGATGCTTAACCGACTGAGCCACCCGGGCACTCTGGATTATTACATTTCAATAAAAAATTAAATGTCAACAAAAATCCCCCA
ATAATTGCAAGCTCATTTAATTAATTTATTATTTATGACATAATAAAACATGCAACCTGAGTTATCCAAATACAATAATTTCTCAGTATTTTTTATCCTGATTGTTGAAAAGCTTCTAAA
GCACCTTGTGTTCTAAAACCATGGTCCGTGCAGCGTGTGACGTGGGCTGCTTTTGTGAATTCTTCTAAAACCAGAAGAACAATCCAATCTGTGGGTGCGTGGTGGTCACTGGAGGATTGA
ACACCTTTACTATCTTCATCCTGCAAACATGCGTGGGACCCATGACCTGGATACAGGAGTCACCCCTGCCACTGGGAGGCCGCCTGGTTTACGACGGGGCAGCCTTGTCCCTGCTGGTTT
GAAGCGAGAGAGACGGACACACAGGGAAGCAAAAAGACAGAGGCAGATGGAGTGCAGAGAAGGCAGAGGAGGAAGACCTGGAAGAGAGAAGGGAGAAGGAGAGTAAAGAGAGTCAAGGAA
GGAAGGTGCCATGAATTGACCACATGACCCGCATGCCCAGGGCCAGGACCCCACGTGCTCGGGGCTGTCGACTTGTGTACTGAAGCCTGGGACCCCACATGCTCGGGGCTGGGACCCCAC
GTGCTCGGGGCTCGGACCCCTCGTGCTCGGGGCTGGGACGACTCGTGCTCGGGGCTGGGACCCCACGTGCTCGGGGCTCGGACCCCTCAGGCCTGAGTTGTGAGCCCAGATAGTTGGGGC
TGTGACCCTGTTTCCTCGGGGCTGTGACCCCATGTACTCAGGACCATGATCCCAGTTTCCCACGAGCTCTGGGCAGTGACAAGGCTCACCCTGCCCTCAGGGCTGGAAGACACTAGCTGT
GTCCAGTGGCGGGGAGGCTCCTGGGGGTCCGGGTGCAGGCAGCAGTCAGCTAGGTGCAGGAGAGCATTCCGGAACAGTCTCTGGAGCCAGACAGAAACCAGCCTAAGAGTGTGAGCATGA
TCTCCAGCAGCAGGACAGGAGGCCACGTTCCGGGCGGAATGCTGGGGCGGAGCAGTGAGGAAGGGTCGTGCTGCCCTGCCCAGGGCTCACCAGCCCTCCGTGCCAGGCTGGAGGAGATGC
TGGGTCTCAGGATCACGGGTAGGCAGGGACCTGGGCTCTGGGCTGGAGTTGCTGCTGGAAAGTGGCCCAGGTGAGTGAGTGGACAGGTGAGCAGATGGTGAGCCCATGGGCCCATGTGTT
GGGGAGAACCTCTGCCCCCTCCCCGCGGGTGCACTGATGCTCCCAGAGAGGGAGGGTCCTGGATGCCTCCAGCGCTCACTGACTTGCCTCTAAGGGCTGTTGACTATTTCTTCCTCACGC
TCCCAGGAGAAGCCTGTGCACAGCTGTGTGCGCACGAGTGGACCCCATGGGCCAGGGCAAACCCTTCTCTCTCCTCGATGCTTCGGCAGGGGGGAGGCGGTGATGCTGGGCAGGCGCTGG
GTTTGGAGATGGACACAAGAACCAAACGCGGTGCCAGGCCGCTGCCAGTCTGCCATGATGGACACAAGAACCAAACGCTTATATTAGTCTACATGGCACGGTGCCAGGCCGCTGCCAGTC
TGCCATGGCTCTCGTCCCCGGGGACTAAACCCTCCCTGCCTGGTAGCATTCAGGGTTTTATGGGAGTTCAGACCATGTGCGGCCCAGCGCCCCCGCCCCTGCGATGGCACTGCCTTGATC
CTGTCCGCTGCAGACGTGAAGATGGTTCTGGGCCTGCCGGGAGCAGAGGAGGACCAGGGAGCATTATGGTGTCAGGAGTAGATGGCTGTGTGTCCCAGAGACCCAGGGTAACGATGGGAG
CCCAGATGTGATGCGGGGCGTCATCACACGGAGAACATGGAGCTGGCGAGAGCCCACGTTCCCCAGATCTGAGTTCAAAATGAGGTATAAGAGGGTAGGTCTTCATTCTTAATAGCTTAC
TCACGTCCTAAAGCTGAGGCCTTAAGACAAAGTGCAGCCGTGACCCAGGGGTGTGGACGTGACCCAAGCCAGGACCCCTGGCGTCCTCACGAGGTGGCTACGGGGGGAAGGTGACCACAG
CAAAAGCGTCTCTGTGGAGAGAAGCCTAGGAGCCTGAGGGTCCTATGCCAGCAGCCCAACCTGCAGTTGTCCCCAGCCTGTGGTGGGACCAGAACAGCCAGCCCCGCATGTGGACTCCAG
GACGAGGGGCCGCCCACCCCAGAGACCAGGCTGAGGCGTGGGACGTGGGCACTTGAGATGCAGCCACCTGGAGTCAGGGCCAGACAGGGAATGGTTTCCGTTCATGTCCACAGTGCCCTC
TGGGGTCACCCCGCAGACAGGACCTTGGACAGAGGAGAGGGCAGCACAGCCTCACCTTGGTGCCTTGGGGTGCCCAGGTTGGCAGGAAGCCCAGGGAAGCAGTCCAGACTGGGGGCCACA
CAGCCAGGCAGGAGCAGCCTGGGCCCCGGAGGATGCCCTGCTGTGGAAGCCCTTCTGTGGGAAGCTCAAGAGGGTCTGGCGCCCCCAGGGCAGGTCTGGGCCACGGCAAGGCACTGTGTC
TGCAGGAGGCCGGGGCAGAGGGGCCAGGAGCAGGGGCTGATGTCCTTCAGTCCTCGCTCCTAGCTGGGCCAGCCCAGGTCTGGACGTGAGGACGTGTCTCGTCAACCTGCTCACCACAAA
GGCTCCCCAGGCTGTGTCTCAGTTCTGTTGGTGAACACTGGGCTCCCGTCACTGTGCCTGTGTACGTGTGTGTGCGCACATACCCATAGAATGATCACGTGTGTGTGCGTGCACACTGGT
GCACACAGAGTCACGAGGGTTTAAACAAAGCCCCGAGAAGGATTCCCTCCAACAACTCCTGGGACCTGCAGAGTCTGAGCTATGGAGGGGGTGGCCCCCTGGGTCATGAAATGTGTCAGA
CCCCAGGCCCCTGCCATCCTGCTCTTGGGGTCAGGGCAGCCCATGCAGGGTTCAGCACGTCGCTCTCTGAGCAACAGGTGTGCTCCCTCCGGGGGGTGGAGGGAGGGGTCTGCAATTTCT
CAGGATGTCCGTGCATTAGGACAGCCACGACTCTGAGCAGCTCTTGGATGTTAGCAAGTCAAAGTGAACACAGTTACAGAGCCCGTTCTGCTTCTGGACCTCGCAGAGGGGCTGGTCCGG
GAAACCAGGGCTAAGCCTCTCAGCCCTTAGCCACTTGCAGTTGTGGCACCAAGACTATGAGCAGGAGATGTGTGTGGTGTGTGCGAAGGACAGCCGGGAGGAAAGCCCGGAGCAGTTCAC
AACTGGAGCTCGAGTTAGAGCCGCCCGGGCTATTGTGGCATCGGACACTACCGGCCTCTCTGGGCGGGGATGAGCTCAGGCGTGCAGGGGAGAGTTTTCTAATGGAGGACAAGGTTTGTG
CGGGAACCTCGTGGGGGCCTTTCTCCATGGGGCTGTGCCCACGATGCACATGCATCCTGATGCGCTCAGGGGTCACTCTGGGGCAGAGGTGGAGGAGGAGAGCGCCTGCTCACAGGCTCA
GGATGTTGTGGCCCCCACCCCCGGGGTGGTCCTCGCCCCCAGCGCCTGTCTCCCTCATTCCCCAGGAGGCCTGGGGACTGGCTTCGGGCCATCCCCTCCCCGGCTCGCTTCTCCTGGACA
CCTTTGTGGCTCTTCTTCCAACGACCGCACTGGTTTCTGCATTTAAAGGTTTCTCCTGAACCAGAACACCTTTCTCAGCCATGGACTTCTGTTGAATGAGTCTGTTTGTCCCCAGAACTG
GCAGACTGGGCCACGAGGTGGCATGAGTCTGGCCATGGGCATAAGGCCTGTTCTTCCCTCTCTGGAGGGGAGACCGGGAGACCTCCTTGCACGTTCTCAGTGCACAAGAGAAACGAAATG
AGTGTGTGTACTTCCTGCGCTCACACTCCGCTGTTCGGGGTGACCCGTGTTGGTCTCCTGTCCTCATGGAAGAAGTGTGGCATCGTGCTGAAGACGCTGGCCTTATGGCCCGAAGACCGA
CGGCAGATGCAAACTCACTGGGCCTCCGCGTGGGGCCTGCTTTCCTCCTCGCCAGCGTGGGGATGGCGTACTCTGGGTCAGCGCTCAGGACTCCTGCACGGCCCCGCAGACGAGCGTCAT
TCCCCACAAACCGGAACACCCAGGAGTCTTTTATGGTATTAGAGACGTAATTCAGAAATTGCTGCTGATGGAAGCCGCACTAGACACCATTTACTAATGTCCCGTCCAGGGTCCAGACCT
GTTTAAAGAGATACGCGGACACGAATTCATGACCTCTCCCCACACGCTTGTGAGGCAGGACAGGCTTCACGCCCTGATGTGCAGAGGCTGAGATAAGGTTCACACCCTCGCCCGGCGGAC
CCCGTGGCCCGCTCTGCTGGCTCTGAGGCCTGCGTGGGAAGCCCAGAGACCCCGCACATGCGTGTGCACACACGTATGGAGTGTGCACACATCACCAGGAAGCGTGGTTGGGAACCTCGT
CCCAGAGGCAGAGTAACGAGGTGGGAGCTTGGCCTCTGCAGACTCCCGCGGGGGTGCAGCTGCCCGCGCGGGCTCCGTCCCGAAGAGAAGCGCCCAGGCCCTTCCCTGAAGTGGCTTTTC
AAGCCCACCTGTGCTGGATCCAGCCTCCGCGCCTGTGGGGACGTGGCCCCTCACGTGGCCGTGTTCACGAGGTCTGTGGCCTTGGGCTTTGCCTCAGTGATTCGTGCTGGGACGTCCGCG
CTCCAGGCTGAGGCCTGGGGACGGGGCTGCAGTGGGTCTGTGCCCCCGGAAGCTTCTGCCAAGTCCGCAGCGTCACAAGGAGCAGATCTCAGGGCAGCCGGAGGGGCTTCCCGCCAGCTC
CTGGCTCTACCTGGGGCCGCGGGGGTCAGGCCCCCTGCCCCCGGGCCCCTGGCCCCAAGATGCTGTGAGCATGTGGGCTGGAGCTGCTGGAATGTGAGAGGCCGGGGATGCAGGGCGCTG
GGGACAGGGCATGGCGCTCCTTGTCAGCGCGGTTTCAGGCCCACCGCAAACGGTGCTGTTGCCTGTTCTGCCCTGTGGGGTTGATTCTCTGACGGGAGGGGGAGGGCCCGGCTGGCGAAC
ACTTGGCCCCAGGGGCTCAACAGGGCTGCATGCGCTCAGGGCCCCTCGCTCACCGGCTGGAACACAGCAAAGGCGTCTAACTGGATTTCGGTGAGAAGGTTTATCTCACTCAAGTCCTGT
CGCTCTACCGCAGTCCTGGTGGATGGCCTCCAGATACGCCCTCCTAGAACCCGCATGGTGCTGGTCCCTGGCATGTACTCCACACCGAAGTGAGTAGTGATTACGTACGAAAGCAGCCGT
ATACCAGTAACCCGCTTTATGTCTCCTCGTGTGCTGCAGAGACCTCAGCAAAAGAGAGATCCCATCTCCATCACGGCTTCTGTCTTTCTCCAAACTCCCTGAGCCAACCAGTCGAGCCGT
CTCCCGAGCGGCCGAGATCATGGAAGCTTCCGTGCGGGCCCTGAAGACAAGAGTCTACGGGAAGCNNNNNNGCCACCCACCGGTGAGCCCCCGAG
GTGCTTTCCTGCCGAGCAGCAGCCC
CCGAGGGGCAGACCCCAGGGCTGGGCGGGGACTGCACGGGCGCTTCTCGCTGGGCTCCATGCTCACTCTCAGGACAGACACGGCGGGTCTTTAACCGCTGCTCAAACAGGCGTGAGATCG
TGTCTGGGTTCGCCTGGGAGGTACCTGTCCCTCTGCGGGGTATCATGGTGTCCAAGAGCGTGGGGAGCTGTTTGCAGGGCTGTTCCAGGAGGCGCGGTCACGTGGGAGCAGCCCGGGGCA
GGTGGCAAGGACGGCGAGCCGCTCTCCTCTGCATGGCTGGGGCCTTGTTACATACTCCCGGCCTTTGAGAGCCGGTTGCTCGACCCTGAACCGGGGACAGTACTGGCTGCTGGCAGAGCA
AGGCAACCTGTTGGTGCAAGACGGGGCACTGCTGCCCGCTGTAACCTCCGGGCGGTCCGAGTCCTGGGATGGGCAACTAGAAAACAGGGTTGTAAGAAACGGACTTACCCAGATTGTTTC
AATGTGGTGTCTCGAGCTACTTGGTCTCTGAGTTCTCCCTCCGAAAGAGCTGTGGACACTTAATGCTGACTTGGCCTTTATGTCTTTTATTTACTTTTATTTTCTTTAATTTGTTTATTT
AGAGTTTTTATTTAAATCTACTTAGTTAACACATATGGTAAAATTGGTTTCAGGAGTAGCATTCAGTGATTCATCACTTATATGCAACACCCAGTTCTCATCCCAACAGGTGCCCTCTTC
GATGCCCATCCCCCATCTAGCCCATCCCCCACCCCCTCCCTCCAGCAACCCTCCCTCTGTTCTCTAGTGTTAAGAGTCTCTTATGGTTTGTTTCCCCCTTTCTCTTCTCCCCCATTTCCA
TATGTGCATCTGTTTTGTTTCTTAAATTCCACATATGAGTGAACTCATATGGTGTCTGTCTTTCTCTCACTGACTTATTTCACTCAGCACAACACCCTTTAGCTGCATCCACATTGTTGG
GAATGGCAAGATTTCATTATTTTTGATGGCTACATAATATTCCATCATACATATATGCCACATCCTAGTTAGCTTTTAGAATAAGATAGGCTTAGCTAAGTCAGGACTCACCAGAAGTCT
CAGATGCCACACTTAACAGGTTTAATAGACTTCATAGCAACCAGCGGTTCACTGGACATGGTTTTGTTTCAAATTGTGGGGTTGAACAATGGTTCTAAGGCCAGTCGTGCGTGCCCAGGC
CCCATCCCGTTGTGCGTGCACGGACCCTGGCCCCAGCACCTGCTCCAGGGTCAGTGCCCCTGCTCAGCCGCTGGGGAGGCAGGCGCTTGGGGAGATCAGTCTGGTGGGTTTGGTGTCCCG
CTAGATGCAGAACTGAAGAACCAAGAACCTTTGGTCTGATTTGTTGAATAAACAGCAACAGAATTGGGGAAATAAATAAATAAATAAGCTGCTTTTTGGGTCTGGGGGCTCGGAGCTCTG
ACTTGCTTTCCTGAATGGTCGCAAAGCAGACATAGGTTTTAGAAGCCCATCTCCTCCAGTGAGCAAGCACGTGGGGATTATTGAAAGTGACTGGCTTGAAGGAGAAGGAAGACCCCACCC
CAGAAGAGGCATGGCAGACGTGGGAGTCCCCCGTGCAGAGGCTGTGGCCCCGTCTGAGACCACCTTCCCTCCCGCGTGTACGGCCGCAGGTGCGTCATTACGAACGGCGGTTGACGCGCG
GCTGTTTCTCCTCAGATGTCCTGCCGGAAGATGTGCTGAACACAATTGCGAATGTGTCCGGATGCCTGCCTTACATGCTGCCCCCTGGATGTCCGAACACCTGCCTGGCCAGCAAGTACA
GGCTCATCACGGGCGCCTGCAACAGCAG
GTAGGTGTGTCCTTCGGGTTTGCTCCGTCTTCTGGCGGCAGCTGGGCTGCAGCAGTGTCAGAGGCCGTCCCGAGGGGGGCTGCAGACCACCT
GGGGTCTTCTCCCACCTCTGAGTGCCCTGGACCACCCCACCTGCCCCGCCCCATCTTCGGGTGCCCCCCTGATGTGACCCCATCCACCAGTGTCCCCTGGACGCTGCCCCACCCTGTCTG
CAGGTGTCCCTTAGACATCTGTCCACACCATCCACAGGTGTCCCCTGGACGCTGCCCCATACCTTCCACAAAGTGGAAGGCTAGGTCCTAGGGTCGGGTTCTGAGAAGGCCCAGGAGCCG
TGGGCTTGACTGGGATCTGAACCTTGAGAAGGATGAGTGCTGAGGAATGTGGCTCCATCAGGCCCAGACGTCGGGTCACAGGTGAAGGACGACCACGGGGCCCCTGATGCAGGTTTGCAC
CAGAGCAGCCACCCAGATACTGGAGGACAGCACAGCTGTGGCCCTGTCCCCAGGGTGGGGCTGGGAAAAAGATGGCAGCCCTTCCTTCCTTCCTTCCTTCCTTCCTTCCTTCTTTCCTTC
CTTCCTTCCTTCCATCCTTCCATCCTTCCTTCATTTATTCAAACGCTGAGTACCCTGAGCCAGGCCCTGTGACACATGCTGGGGAATACGACAGCCCTGTCCTCACAGAGCTGATGGATG
GGACCACAGTCCCCAGTGGGTCTAGCATAAACAGGACTAGCTCCCATTTTTATTACAGAGTTTCGCAGTTTGAAGGCTATGTCCTATGATGACTGTGCTCCCGGACCAACCAGAAACACA
GAGCAAACCTCAGAATGAAACAAAATGGTGCGGGCCATGTGTCTGGTCATGGGGCTCACGGGGGCTGCTGCCACCAGGCGGGGGCACGTGTCCAGTTCACAGTTCAGGACAGAGGGTAAC
GCCTGAGTGAACCAATCACCCAGGATGCATGGGATTCCTGGGATGGTCAGCGTTCCCTCCTACACCCTGTTAAAGCCTCTGCTCATGCCCGCGAGAGCATCCCTCTCCAGCCCTCTCCCC
AGGAGGGCTTGGGCCCCTCGGCTCAGCCTCCCAGGTCCCTTCTGCAGGGGCAGGACGTCCCCCGGCCCGGAAGCCCCGTCCAGGGATCTCGTCTCGGTCCCTTTCCTGGCCAGGCCTGTC
TCCTCCGTCCACTGCTCGCTCCCCAACGGTGGTGAGTCTGCCTGGGGCACAGGCTGCCGAGGGTGGGAGTCCTCAGTGCACATGTACCCCGCTCAGGGGCTGCCCCCGGGTCGTGTCTGT
GCTGCACACACCCACATGTGCGTGCGTGCGTGCTTCCGTGGCCCGGGTCCAGCCCGCTCCGCAGTTTCTGTGCGATGCCCCCGGGCATGCTTAACCGCGGTTTGTTCAGATAGAGGGACT
GGAGGCTCGGGACGCATACTCACCCGAGAGCGCGTCTTCCCTCTGGGTAGTTGCGGTTCTTGAGGTGAGTCTACAGAATTGCCGGGTTAGAGCGTCACCTTATGTTTCCGTTTTGAAGGC
ACACGTGTCATCAGCAGGACGCTAGGGTTGCTATCCGTTTGAGACTCACCAGTGGTCAAACTTAGTTACAAGATTTCCAGGAGTTCAGTCTCTGAGACATCGGTCTTTACCACCGCGTTG
TGCTTCGGATTTTTTACTAAAATTTCTTTCTTGTTGCTCTGGGGCTTGTTTCCCTGTTGCTGTCTGTCTTCTAGACTCGAACGTGAATGTGCAGGGGGCTGTTTTCTGCTTTCTCTTTCT
TCCTTAACGGAGTCGCCTCTTCCCCTGTTGCTGCTGTGGGCAGGGAACCGCGGGCTCCGGTCCTGCGTACCGGCTGCCTGTTGGCCTTCATTCTGTCTTTAATCCAAGTGTGATTTGGAA
TTTAACTGTATAACTTCCGAATTTCCAAAGGGGGGATTGAAGAGACTCCTCCATTTCTACTAGATTCCCTGCAGTGTGGGGTGGTGTGTGGGCGTCACAGGCGTGGCTGTGGCTTCGCAC
GTTCGTTTTCCCTTTGCTGAGAGTATGCCAGGTGCTGGGATACACCCCATGAAATCAGTAAGCAGAAGTGGAAAGGAAGGATTTCTGCAGTCTCGTGTGTAGGGCGTGATTGGCGCTGCA
CGTGCGTTACGTGCATGAAAGCGGGGGCAGCGCGTGTTTTCGGGGGCCCTACTCTGCTCTCGGGAGCGCTGCCCTCGGCGGCCCCTCAAGTCCCACATCTGCCCGGGTTTTCTGGGCGTG
AGTGTGTGGGCGTGCCTACTGCTGTCATCCTTTACGGTAAACTTGGATCTCAGCGGGGCTGCTGGATGCGGTAGTGAACACTTGAAGACTGTCGTCGGCGTTCCGGGCCCTGTTTCTGCC
TCGTGCAAGGGAAGGGTACTTACCTGGGAGAGCTCGTTCTGGTGTTTGACAGACAGAATTTCCATAGGTCCTTGCGTGCAGTCTACAGCCGATACTGTAAGTGTCACCGTGATTATCACC
ACCAGTGACCAGACAGTATGTGACCTCTGGGTTCTGGGCCCAGTATTAGCCACAAAGGGCCATAAACGTAACTCCACGCGCCTTTTCCTGCAAGCAGGACTCCCCCCACCAGTCAGCTGT
GAAGTACTCAACTGTGGCGATGGCCGAGCCTCAAACTTACAGCAGAATTTTCCCGGCTCAGGTTTACCGTCAAGTTAACGATGACTGTTTGCAAGCCTGGCCCTTGGCATCTCTAACCTG
CCCCCCAGACGGGTGGAGATTACAGACAACGTTTCCATCCACACAGTGACAGATACACCGCCTGTCACTGGGTTCATCTGGTGCATGGCCACACAGGCAGAGTGGGAACGGCCTGGCAGG
CTGCAGGACGTCACCCAAATCCGTTACATGATGATGCTGCTCGGAGCCTCATCCTCGGGGAATTCCTGACCTCAGAACCCGTGAGTTCCTAGAGGAAGTGATATACTCTGCAGGCAAAAT
CTGATTCATGCATTTGAGCTACAGGCCGAACCCCAGACCTACCTGGGCGTAGTGTGTAATTTGCTGTGTATAAAATTCTGCATTAATTTGTCGAAACAGCTGTCAAAACCCAAACTAAAT
TTGGGATCTGTCTTCCAAACGTGTAAACACGTGTGGGTGTATGTCTGCCCGGCACCTGCAGACTCACCCACCGGCTCCCTTTCCCTCTGGACACCTGCCGCATGGTCGGTTCTCCTCATT
TGTGTTTTGATGTAACTCGTGAAACCGTCTGGCCGAGGTGACAGCTTGCGGGTCTTAACCAGAGTGGACGTCCTTACAGAGCGGTCTCCCGCAGGCTTCAAACTGTAGCCACCAGACAAC
AGATATGGGCTGCTCGGAGCCCAAGCGGCATGAAGGTTGTTTGCAATACTGGCCCTTGAACCAAAACAAAATGGAGCCCCTGATGGGTGCACGCTGCCCCTGAGGCCCCAGGACGCTCGT
GTGTCTGAGGAGTAGATGTTGCTGGTGTGGGTTTCCTGCGTGAAATACGTGGAACATCACGTGGGTACGAATGACGCCAGAAGAGTTTGGGGAGCACATTGAGTCCATACCCATGATGGA
AAAGCACGGCATCGACCAAACCATGTGCTCGCAGGTCTGCGGCACCTGCCGTCACGGAGCTCCAGCCCGAGGCCCACGCACCATGGGCTGAGCTTCCTCACGCTTCTGGCTGCAGGACGG
GGCATCAGGCACCGTAGGAGCCATGCTAGGTCCTGGGCCACGTGGGGACCCTCTGGGTCTGCATGCCCCCCCACAGCCGTGCTGCCCGGATGCACACGCCTCGCGGATGAGGGGGTGGAA
AGGATGCGCTACTGCAGAGGTCAAAGGTCCGTCGCAGTTTCCCCCAGCATGTGACCCTCTGCGATGCTGCTTCTGGAGCAGGCACCACGCACAGTCCCAGTGCTCCCATGTCCGTGGCCA
GGAGGACACCCACGGGAGCCTCCCAGCATCCACCGTGGACTTGCATCCACATCCCGCCAGCCTGGAAGTTGGACCTGCCTCTCTCTTTAGAACCCGGGGTGCCTGCAGCCTCTAAGAGGG
GCTTCCAAACATTGCAGCACCAACCGCTGTGTCCTTGTAACCTCTCCCCCGGAAACGCTCCCGTCCGCTCACTCTGGCCAGCTTAGGGCCATTTCCTTCACGCGGCCAAAACCCAAAGCG
AATAAACCAGTGATGTGGAGCTAAACGTCAATCCCGCGGCGGGCAGATTCTTCTGACACGGAGGTGACGCCGGAGGCCTCATGGGGAGGCCGTGTGAAGGTCCCCCGACGGCACCAGCCA
CGCTCGCCTGGGCTCCCGTAGGGCAGGCTGGGGCTCTGGCTGTGAAGGTCAAGTGCACAAAGGCGAGTGTCCTGCTCTCGCGACAGCTGCAAGCTACTGAGGTAAAAGTCAATCAGCACA
AAAATCATGGCCTAAGCAGTTAAATGAACATTTCATTACTTTTAATGGAGTGAAATGGCACCTCCCCCCAAGCAGCGGAATTTCAGTGAAGACGAACCAACCGTGACAACCTGACCCTTT
GGGAAAGTGCACGTCGGTCCCCCCGCTGACCTACTGCCGCTAATTAAGTGTTCCGCTGTCCCAGGTCGTTCTACAAACAGAGCCGCTTGCGTGTGCTGGAGATCAGTGAAAGATTGATGA
TGGAATTGTGCCCCAGCCACTGTCCCTGCAGACGCACCCAAGCCCCCACCCTGCCTCCTGCTAGCGCGTCCCTCCGGGGGGGCTCCTGGCCGGGGCAGCAGCGGTGTGAGAGACACGGCG
GGAAGTCCTTTCCCCGTGTCCGGAGCTGTGTGGCACCATTAGGAGAAGCGCAGTCCGTTCAGTGTGTCACGGAGGCCACAACTGCGTCTCGCCTTCAAATGTGCTGACCCTTCCTGCCCA
GAGTAGCAGTCGTCTCCGCAGCACGCGGTTCCTTTCACTCTTAGGCAGAGCTTCTCAGTCACATTTATGGAAGTATGATCACTGTGGTGTCCTTGATCGTGATAATAATGTGTCAAAACA
AAGCAACAGATTTTTAAATATTTATATTTCCGAATGCTCCAAAAACTTTACAAAATCGTTCAGCTTGTCGTGATTCTCTTAGACTTCACTACTTTGATGTTCCAACTGTCTACACACCGG
ATGCCTAAGACACTTGTTAAAGAAGTCTAGATCCCAGTCTTTTCCAACTCTAACCCTTTGGCCTCGTGGCCCCCTGAGCCCGGACACGTGTCGACCACACGCCTCCAAACTGGCCTCACA
CACTTCTTTGCAAAGACCTGCAACGACGGCACAAACGCCCCCACTGCTGGGTGTTCCTGCGTGGATTTGGTTGACAAATGCCAAGGGAACGTGAACACCATAACGATTTTATACTCAAGT
TATCCATTTAAAAAAAAAGCACAAATTTTTCTCTAACAGAAAATTCCCATTTCTTTTTGCTCTTTGAACTGATATTTCCAGTCTAATTCATCTATCATTTTTTTCCAAATGTAGGATATG
TTACGGTTACAATTCTCACGTTTGTTTCCACAGAGACCACCCCAGGTGGGGAGCCGCCAACACAGCCCTGGCGAGATGGCTGCCGCCCGCCTACGAAGACGGCGTCAGTGAGCCCAGAGG
GTGGAACCCCCACTTCCTGTACAACGGCTTCCCACTGCCCCCG
GTAGGTGCCTCCACACACTGTGCAAAGGGCACTGGAACCCGGTCCCCGTCATGCTGCCAGACCGCCCGCCGTCTTGG
AAGATGCCAGCCTGCTGCTGAGACCGGGCTCCGGACGGCGGGCCCCAGGCGGCGTGCTCACAGAGCCCCGTCCTCTCCAACCTCACAGCACCTGTGCTCGGCGGCTTTGCACCCTCCCTG
CTCCCCAGCTTGGGAGCTGAGGCGTGGAGAGATAAAGTCACCAGTCAGTGACTGGGACGGTGCAGATTCAGATTAAGGCTCGTCTAACTCTCTGCTCTTCTCGATCATTTCGGTATTTCG
GTAAAGATTTATTTATTTGGTGCGGGGCGAAGAGCAGAGGGAGAGACAGAATCCCAAGATTCCCCGCAAGTCCCGGAGCCAGGTGTCGGTCTTGATATCACAACCCTGAGATCATGACCT
GAGCCGAAACCAAGAGTCAATTGCTTAATCGACTGAGCCAGCCAGGTGCCCCTCGTTTTGGCATTTTGAAATAAATTCCTTCATCCGTAGGCAGAGGGCGATGTGTATTCAAAGGTACTT
AACGGTTAGGTGATTCACTCACTCATGCAAAATGATGATTGCTGCTTTACTCCCAGAAGCAAATTATTTGCTAAGCAAATTCATATCCAATCCAATGATCAGTTAGGTTAAAAAGTGGAT
ATTTTGCCCTCAATTTGACTACTTGCTTCCATGTAATAAACTAGTCTGCCTGGTTTTATACTGTGTGTGACCATGGACTTCTCCAGAAATAGGACAGTAACGCTCTGTTCAGCGTGAGCG
GCCAGGCTCTGACCACATCAGCTTGGGCACCAGTACGCCATTCCCAGGTTCCCCTACAGAAGCGATCAACTTCCCTGGGCCCTTCTTGCGGATGGCCACTGAGCAACGCACGTGCTCCTG
TTCACAGCTGGGAGCCGCGCCGGGGCTGGTGGCTGGCCTGTGGGAGGGCATGGCCCCCTGCCTGTGGTCGTCCCCTGTACCTTTCTGCAGGTCACTCTCAGTCTACAGTCGACTGTCCCT
AAAGGAGGAAGTAATACCTTTCCCATTCTGCAAGATGCCAGGCCTGTTCAAGCCCCAGGGCTCCCTGAACTCTCAGTGTTAAGGGACTAGGATTCTGTAAACCCATATTTGCCAGAATTT
CATGGCTGCTGGGAGCTCAGAAATCTCTAACAGGGGCTGGTAGGTTGCTGCTCCTGCTGAAACCACTCCAAGTCACCGTCCTCTGGTTCTGGAGGTGAGAAGAGTGACGTGGGTCTCGGG
GCTGCGACCAGGTGTGGGCGGGCTACGGAGGACCCTCTTCCCGGCCCCCAATGCCACATCCCCTCTGACCACAGGCGGGACAGGCTCTCAGATTTGAAGAACCAGGCGATTGTGATGGAT
CCACCTGGAGCCCCAGAAGAGCCCTTGTCTCAAGGTCCTCAGAGTAATCACATCTGCACACATGTCCAGGCCTGGGAACAGCCCTCAAGGCCCCCGGCCCTGCCCTCTGAGTCATGGCCA
TTATCACACCAATGGCTCCCCATCCCGTGAGCGAGCGTCCCGATGTGGGGGCTCTCCCATTGTCCTCTTTCTCTGCAGGTATCCATCCCACAGGACATGCTGGTCTCTCTCACCAGGTCC
GGGAGGTGACAAGACAAGTCATCCAGGTCCCCAACGAGGCCGTCACAGAGGATGACCAATATTCTGACCTCCTGATGGTGTGGGGGCAGTATATCGATCACGACATTGCGTTCACACCTC
AGACTACTAGCAAAGCTGCATTTGGGGGAGGAGCTGACTGCCAGCTGACCTGTGAAAACCAAAACCCATGTTTTCCCATACAG
GTAGAATCTTAAACTTTTTATTATTTATTATGAAACT
ACCAGATGTCACTTAAAAAATCAAACAGAGAAGTATAAATAAAAGTCAAAACCCCCATTTGTCCTGTTTGGGGAGCAGGGAGGTAACAACAGGAATATCCTGCACATCTGTCCAGAAATT
GTCCTCACATGCATGTGCACAGTGTGCATGTGTGCATAACCTTGCATGTGTGCACATAGCGTGTGCGTGTGTGCACGGCATGCGTGCATGTGCACGCGGTGTGCGTGTGTGCGCATAGCG
TGTGCGTGTGTGTCCATAGCGTGTGTGTGCATAGTGTGTGTGTCCATAGCGTGTGTGTGTCCATAGCGTGTGCGTGTGTGCATAGCGTGTGTGTGTGCATAGCGTGTTCATGTGTGTGCA
TAGCACATGAATGTGTGCATAGCACATGAATATGTGCATAGCGTGTGCGTGTGTGTGCATAGCGCATGAATGTGTGTGCATAGCATGTGCGTGTGTGTGCACAGTATGTACGCAGCATGT
GCATGCGTGTGCATCACGTACAGCTGGCATGTCCTGCTACGTGCGTTGCTCTGAACCCAGTGCAGGTCACTTAGCAATAATTAGTATACTTCTCCCCATACCATTAAGTGGACAGAAATT
TGATTGTTTGAAGACTTCTTAGAGTCTTAAAATATGCATTATAACCTATTAACCAGTTTGCCTGTTCATGAGCACTTAAGTTTTCAACTTTGCTGTTTTCATGCCGTCACAAATAATGCA
GCGAGGCACGTCTCCGGACGTTAGCCGTGGTGCCCGTGTGTGTACCTAACGGGCAGGCTGCCAGGGGTAGCACTGCAAAGCTAGGGGGCACGTGATGACCGGCACAGGTATTGCAGAATT
GGTCCCCATAAATATTGTTCTCAGGTCCCCTCTTACCAGCAAAGGAAGAGACAGGACAAGTAGGGGTTTAATCACTTCACTGTAGAAAACATCTTGGAGGCTGGCAGGCGGCACTTCCTA
CCCAAGAGCAGTCTGGGCCACGTCCTCACTGGCATCCGCCCCTGCACCCTCGCCAAGCAGCTGCTCTGTTCCAGGCTGTTCCAGTCTGTGCTGTGTGCCTGGAAGGGGGGCCCACACTGG
AAAGGGGTCCACCCTGGAAGGGCTTTCTGGTGGGCAGGCCAGATAAGAGAACCAGCAGTTAGGACCCTTTCGTCACATGCCGAGAAGTCCCCAACAGGCCAGGCATCTAAACAAAATACA
CTGAAGGGAAAAATCGGGAGAAGGGGTAAGACAGCAGAGCATATGGGCTGCATCGATCACAGCTACCAAAACCCCAGCCTCCTCTCACCTCGCTGACCCCGGCAGGAGCCGGTGGCAAGC
TGGAACCGAGCGTAGGGACAGGAGTGGATGGGGCACAGAGTGCCGCCTGGGGGCCCAGGGCCATGGCCAGCCTAGAGCTTCCAGTGTCTCTGCTGAGGCTGGGTGACTCCATCTCCCCTT
TCTCGACAGCTGCCCGCCAATGCCTCAGGGACCGCGGGGGGCGCATGTTTGCCGTTTTACCGCTCCTCTGCCGCCTGTGGCACCGGGATCCAAGGCGCCTTCTTTGGCAACGTGACCTCG
GCCAACCCGCGACAACAGATGAACGGGCTGACCTCTTTCCTGGACGCGTCCACGGTGTACGGCAGCTCCCCGGCCTTGGAGAAGCAACTGCGCAACTGGACCAGTGCCGAGGGGCTGCTC
CGGGTCAACACGCGCCACTGGGACGCCGGCCGCGCCTACCTGCCCTTCACACGGCCTCCTGCACCCACAGCCTGCGTGCCTGAGCCCGGCACCCACGGGACGGCCGGGGCACCCTGCTTC
CTGGCAGGGGATGGCCGAGCCAGCGAGGTCCCCGCTCTGACGGCCGTGCACACGCTGTGGCTGCGTGAGCACAACCGCCTGGCCTCCGCGCTCAAGGCTCTCAACGCTCACTGGAGCGCC
GACACGGCCTACCAGGAGGCGCGCAAGGTGGTGGGCGCCCTGCACCAG
GTGCGCAAGGTCCTGGGGTGCCCCACGTGCTCGTGTGGGCGTGTGAGCTGGGTGGGTGAGGGGGTCAGAGTA
GAAAATGGGATCCTGACACGCGAACCGAGGGTCCGAGGCTCCCATTGCACACACGGCGCAGTCTGGACGAGCTCGCCTGCGAATCAGGACCTCACTTCCCAGAGGCGGAGTGAGTGATGT
AAGGGAAGTGGGAGCCATGTATGATCTGCGAGGGGGATTTAGGCAGACCTGGAGGACAGCATATAAAGTGACCTGGAAACCTGTCACTGTTGTAAGGAAAATTCAAATAGCTTGTTGGAC
ATGATCTGACCTTGAACAAAGTGGTGTTGGACTCAGGCTCAGGGAAGGGTTCCTGGGTTCCCACTGGGGGTGTCTTACCCCCTCCTCTGCCGTGGGCAGTCCTCCTGGTTGTGTCCCCCT
GACGGGAACGTGCTTGGTTGTGCTGTGTCTGTTCCCCTTCCGCAAGCGTGAGCTCCATGGACACGCGCTGTCCACGGTCACACTGTTCTCCTGGCCGCTGGACCAGGCTGCACACAAAGT
GGGCTCTTGGGAGTGTGTGCGGAGCTTATGCGGGAAGCCGACAAGTCACCCCATGTCCACATTTCTTGGCTTCACCGTTCACTTTCAGATTCCCTGGTGTGTTTTTTTCAGTCAACAGCT
TCTCTTCGGTGTTTTTAGAAAATACGTCGGAAACCCTAAGATAACAAGACGTTGCATTTAGCGTTGATAAAACCCTTGCTGAGGTGTGGGCTGTGTCCGAGAGGTCCCTGGTGGACTGCA
GACAGTCCCTCTTTCCTGCTTCCATGGTCTGGCTCTCTCCCCTTCTGAAAAGCATTCTGTCATTAAAAGGAATGTCTGCAAATTAGAGGAAGAGAGCAGGCCCAGCCACGGCCACCGCCC
CAGCTCTGAGCAGCTAGGCCCAAGGACACACGGCCCAGCCTTGGCGCTGGTCCCCCCACACACCGGAAACAGAGGTGCGCCTTCTGCCTCCTGCACCTGCGAAGCCTGCACCAGCCCCAC
ACCAGCCCCACACCTGCCCCACACCAGCCCCACACCTGCCCCACACCTGCCCCTCTCTGTCCACCAGAGCCCCACGCCACTCCCCTTGGAGGCCTTTACCCCCACTTCTTCTGCAGGGTG
TTCCCCGGGGTCCCTTCTGCCCTGGAACAGTCAGCCCTATGAGGGCGTGCCCCCAGTGTCTCCCCCCCACCACTGGCGCCTCTGGGGGTCTGCTCAGAGGAAGTGCTCAGGACAATGCAC
CCTGTGTCCCCTAGGACCACAGGTCAAACTTCAGAGAAGGGGGAGAGGAAAGCAGACGTCTTTAGAATCTTTTCCACTGGAACTTAAAGTCGCCTTGTGTCCATGGCAAGGAAGAGGAAG
GCCATTTCCCTTGTGATGTGGGGAGAACAAGCAGAAGTGGAGCCTGGCCCACACTGGGCCGCGAGGGCCACACCGACCTCCTGCCCAGAGAAGCCCACGGATACGCCTCTGAAACCAGCC
TGGCCTGAGGGCCAGGAGCTTCGAGACGAAGTCATGACCACTCTGCATGCTGATCAGTGACCCGCATGCTTCTCACTCGTCCCTGAACCGGCTCGGGGATGACCTGTCAGGCAAGGAGTG
CTGGACCAGCCTCCATTCAGCGTCTTCCAGGCCCTGGAGGTGAAAACATGCTCAGCGGTGCCGTGGGGCTCGGTCCATCCACCCCTCCAACGGGTCGGAGGCTGCACACCCGAGGCTGCC
GCTCCCTGCTGCTCTCCTGCAGAGTACGGATCATGCGTTCCGAAAACACATCTTATTTGAAAGAGACCGATTATAAGGAGGCAGATGGTAGCTGTTGTTTGTTCTAACAGTCGGAGAACG
TGAATAGCTTATCTGCTACAACCGATAGACCTTTATGTTCTGGGACAGAATCACTCCTATTGGCTTATAACTCTTTGGATGCCATTTATTGACCAAAATCTTTTTAAATACTGAAAGAAT
CTGACACTGATTTTTACAACAAAGAGAATCACTGTTAAACCTACAAGCAGAACCCTCATACCCCGTCCTCTGGGGAGCCCGCACCAAGCAGGAACCACAGGCCTAAGGTGGCCTTGTTAC
TGCTGACGGGTCTCCTCCGCTGCTAGGGGCACTGGAATCAGAGACCGTGGCTGACGCTCCGCAGTGAGGAAGGCGCTCCCACGCGGCGAATCCGCAGGTGTAGACCTGTGCCGCCCACGG
CCGAGCCCGACTGAGCAGACCTGAGCGTCTTCCCCGGCTGCCACCAGCCCTCCTGCTGTCCCACGAAGGCACCTGCAGCCGGCTCGCAGAGCTCCTGAGTACCTTTCTGAGAAACCACCT
TGAGGCCTGAGTGCAGGTGGGGCGAGCCCACAGAGACCCCATCCAGTCAGCGCACCGCGTGGTCCCATGATCACAAAAGCCGCCTGCCAAGGCTCACGCGCCAGGTCTCTCCTGTCTGTT
TAGACATCGCGGTGCGTCTTCCAAAATCGGATGAGGCCTCATTTACAAAACCCACGCATGGTTTTCGCTCCTGTGGAGACCCTGCCAGCCCCTTTCCCTCCTGTTTCTGTTGTGAAGATC
TAACAAGCTGACAGAGTTCAGGGGAAAAGAAGGAATAGCACAGGGGTCCCAGCATGACTTAATCTGCCAGAGACGTTCAGATCACCAGTAGCCTACAACTGGTGTGTCGTTTCCTTTCAG
CTTGTGGGGAGGGGTCCTCCGACACACACTGACCCGCTCTGGGTAATAAGTACGTCTGCCACATGGAGACCACACGACAGACCCAACAGAGCAAAGCACGTGTATTTTCTACTCTCACAA
AAGCTCTGTGATAAAGGCTTTTCCAGATAAGGAAGCCAGATCGGAGAGGCCACCCAGCGCCCCAGCCACCAGAGTTGCACAGCTGAGAAGTAGGAGGTGGGATTCGAACTCACGGGCCTG
AATCCTGAGCCTCTACTGATCAGGTTCCTTGAAGCGCCTGGACCTCTGACTTCTCTTCTGAGCTCAGACGTTGATGGAGTGCCCACGGTGAAGGGGGCGAAGAGGTTGGGCCAGGGGTGC
AATGTGGCATCCAGTCTCTGTGTGGTGCACCCCCAAGCTTATGTGGCCTGGCCTGCCCTGGGGGGTGTTTGGGGGTGTCGCTGACATGCCCCCCGGCCCCATAAGTGTCAACGCCGTGAG
GATGCTCTTTGGATCCAATCACCTGTTCACCTGTCCCCTTACCTGGATGGCCTGTCCGTCCTAGGACAACTCTGGCCCCCGGGGATATGCAGGAGGAAGTCCTTCCCTGTCACTGCCTGT
GGCCCAGGTCTGGCACCGAGGGCCCTGCCGCCAGACGCCCCTGCTCAGAAGCTCTCCTGTTTTCCTCTCTCCGTAGATCATCACCATGCGAGACTATGTCCCCAAAGTCCTGGGCCCTGA
GGCCTTCCAGCAACACGTGGGCCCCTATGGGGGCTACGACCCTGGCGTGGACCCCACCGTGTCCAACGTGTTTTCCACGGCTGCCTTCCGCTTTGGCCACGCCACAGTGCACCCACTGGT
GAGGCGGCTGGACGCCCGCTTCCAGGAGCACCCTGCCCTCCCCCCGTTGCGGCTGCAGGACGCCTTCTTCAGCCCCTGGAGGCTCCTCAAGGAAG
GTGCGCCTCCCCTCCCGCCAGGGCT
CAGCCTCTCCCGCCGGCTCCCTGGAAGAGCCCACCACCCCGCGGCGAGGGCGTGCTTTCACCTCCCAGCACACGGGGCTGAATACTGTCAGTGTTTAAGGGGGAAATAAATGCCTTCAAA
GCCTTTTAAAGGCTGAACTGCTCATCCAGACACCCCCCTCGGGTTTCTGACCTTCTTCGGACCTCACAGGGTAGCCACCCGGGTGCGAGCGCCTCTGCCCTATTATTTCAGAAATGCCGA
AGTAGAGACCGGCGCACACCTGTTCGGCGTAAATAAGTCCACCTTCCCATCAAACGTGCAGCCTGCTCCCACCTCGTCCCCACCACAGAGCCCTGGGGCGTGAGCGTCCGCACAACAGGT
GCTGGGAAGGGTTGTTTCTACCCCTTGTCCTCCCAGCGTCCTCCTTCTAGAAGCTTCTGGCCCGTCACAAATGTGCCTGGTGCCCGGTGGACGCAGCGGGGGGAGGTGAGGGGAAGCAGT
CACCACACACGATCTTTGCTCCCTAATGAATGTGCACAGAACATTAGGGAGAAAGGCTGGGGTCACCCGGGTCACCAGGACCCCGAACATCGATGGTACCCAGGCCAGCCCCCCACAGGC
CAAAGCACATGTGCTTTCTGAGTTGTGCTGTTGGGGCCCCAGGAGGCCAGACAGGCGTGATAAAGCTCCCTCCGCCATGCGATCAGGGTGGGAGGGAGTTGAGAGGTGGGCTTTTCCATA
ACGGGTCCTGTGGGCTGGCTGGCACTCGGAGGTGAGGGTCACAAGTGCCCTGACCCACCCACCTCTGCTCAGCCACCCTGCACGGTAGACTCCAGCTTCCCACCCCTGCAGGCGTTCGGC
TGCGGGAACTGACACGAAAACTTCAGCACCGCCGGGCTCCTTCTCTGGGTCCCCTGCGGACCTGAGGCCCGCCCTCTGCACCTGCTGGTCAGTCCTCAGGGACCCAGACAGATGTTAACC
CGCCCACTCGGCTGAACCCAGGCAGTACTCGGAAATCCTCAGAATCACGTAAAGTGAATTCATGACCTTGAATTCGTGACCGTGAAGGGTTTTCTGTTGAGAACAAGCAGAGTTTACTGT
GTGAGGTATTATTACTGTTTCTCCAGGACTCATGAGATGACCTCACCTCTTCCGTGACGTTTTCCAGGTGGTGTGGACCCCCTGGTGAGGGGCCTTCTCGCGAGACCAGCCAAACTGCAG
GTGCAGGACCAGCTGATGAATGAGGAGCTGACAGAGAGGCTGTTCGTGCTGGGGAGCTCGGGCAGGCTGGACCTGGCATCGATTAACCTGCAGCGGGGCCGGGACCACGGCCTGCCAG
GT
CTGCCCACCCCCGCTCCTTCCTGGGCTTCCCTCCCGCCTGGGCTGTGGGGGCGGCCACCTGAGAGCCCGTTCCATCAGAAGCGAAGTGTCTCCAACCTCAAGCCAGCTTGCTCCTCTCTG
GTTCTTCCGCCGGGAGCCCATTCAGTGTTGCTTCGAGGACAGAGCCTCAGGGGGTGCCCAGGGCCTCCCAGTGGGCAAGAGCCCGGGCGTTTAGAAAGAGCAGTCCCCAAAGAGGGAGAG
GGAGGTGGTCTGGCCTGGTGCTTTTTGGGAAGTTAGAAGGGCCGCTGTTCTGTCTGTCTCTTCCTCTCACCGCGCCCTGGCCAGCACATCCCTCCAGCTGCCTCTAGGGCGTCACTCCCC
AGCGGTCCAATCCCCTGGCCACTCTGTGGATGGGGACCCTCTTCTCGGGCCAACCCCCAGTTTCCGACTCCCACTTGCTGTGCCCACCCCAACCGCATCCCCCTCACTTGTCCCAACCCT
CCCCACCCTGAGGCTGGCCTGATGCCCTGCCTTCCGTGGCCTTTCCTCTGGGGCACCCATAGTCCAGCTGTCTGGTCAATTTTGCTAGCCGTGCAAGGCCACCTGCCACTCAGTTCCCGT
GTGCAGACCTGCCAGGTGCCCAGGGAGCCCCTCTAGGCCAGGGCCCACTCCGCACGTGTCCCTCTGCTGCGTGTGTCGGGGGCTCATGGACCCGCCATGGGGAGCCAGGCCTGCTTGTTC
AGGGTCCCCCACATGTGCTGCTCTTACCTCCCCCTCAAAGCCCCAGGAGGTCTAGTTATGATCACTGTCAAAGACGGTGTCTTCCCACCTTGTTTACGAGCAGGCTCTTCAGTGAGATCC
CGACTGGGGTGCGGGAACATTCGGTGTGTTCCGCTCCGCGGGGCACCAGGTAGTGGAGTGGTTTCTCTGTAGCTGGGCATTGCAGACGGGACTCGGCTGCTCCCGCAGCAGCTCCCGGTG
CAGCCCCGCTCTGGTCAGGCAGGTGGGGCGGACGCGGGGATGGAGGGAGATAACACCGCACCCCCTCCTCCCTGCAGGCTACAACGCATGGAGGGAGTTCTGCGGCCTGCCCAGACTGGA
GACGCGGGCCGACCTGCGCTCTGCCGTCACCAATGCGAGCATCGCGGGCCGCATAATGGACCTGTACGGGCACCCTGACAACATCGATGTCTGGCTGGGCGGCCTAGCCGAGACCTTCCT
GCCCCAGGCGCGCACGGGTCCGCTGTTTGCGTGCCTCATTGGGAAACAGATGAAGGCCCTGAGGGACGGAGACCG
GTGGGTATCGCAGCCAGGCACTTCCACACAGGCCCCAACACAGCT
GCGTCGTGGGCGCTCCCGCAGCCCGGCTGGGCCGTCTCTGTGGGGCCGTGAACCTGGGTCATCACAACTGGAGCACATGCAGCGTGAGCGCACAGAACACTTGAACTGTGAGCTGCTGTT
GCCGCGTCCGAATGACCCGCTCTCACGCTTGAGCGGGCATCACGTGGAGAGCACAGGTGTTCCTGACGCCCAGAAACCCACCTTTGGGTGTTCTCTCACACATCTGCCGAATTGGGCACG
TGGGTGCTGACCGAGGCATGAGGCCGAGCCCCAGGGACGGGGTGGGTGCGCTGTCCATGTCGCTCGGCCTGGGACCCCACCCTGCGAAGGTCCCCGAGGGAGTCTGCCGAGCCAGCCCCT
CATTCCAGGCCCAATGTGTCAGGGGTGAGGAGTTTGGGAGCCCGCGGGCGTGGTCGACAGCGCAGGACACCTGTCTGCCCAACAGGAGGCGTCCTCAGCCGCGGGTCCCCTGCAGCGCAC
TCGGCCCTCTCCTCCCGTGCAGGTTCTGGTGGGAGAGCAGTGGAGTGTTCACCGAGGCCCAACGGCGCGAGCTGGCGAGGCATTCCCTATCCCGGGTCATCTGTGACAACACGGGCCTCC
CCAGCGTGCCCGCAGACGCCTTCCAAATCGGGAGATTCCCGCAGGACTTTGAGTCATGTGAGAACATTCCGGGTCTGAACCTGGACATGTGGAGGGAAGCCCTTCCTCAAG
GTGACGTGA
AGCCCATTTTAAATTATGTTGTAGCATGTGGGTTGTTTTCGAGAGTGTCATGTGCCACAAGGGGGGGTGGGCACCCCACGTCTGAGCTGCACGCAGGTCCCCCGAGTCGGGGTGGGCCGG
GGGGTGGATGAGCGTGGGGCTGGGGGCACAGGGCATCCACTGGGCCTCCGTGGCGCTGTCCACAGAGGTGCACCCGGTGCCAAGAAGCTGTGTGCCCCCCTAGGCCGCGGCAGGCACGGC
TCCGGCGGGGAGGCGGGAAGCTGGGGAGGCAAGGAGGTGGGCAGGTGAGGAGGTGAGTGGGGAGAAGGGAAGGGGGGAAGGGGGCGAAGGGTGAGGGAGGTGAGGAGGTGAGGCAGTGAG
GGCCCTGAGGGGAGCCCCCAGAGAGGGCCTCAGGAAGGAGGAAGGCACGTGGCGCAGAGTCGTGGCCGCCAGCCCCGGGCTTGGTGACAGGAGCGGTGTGTCGGGTGGGGACAAAGCCTG
GAGAAGTTGGTTCAGGGCAGCGACCTGAGGCAGTTGGGGTTCGTTCCTAATCACCACTGAGCCCCGTTGTGCGCGGCCTGGACGGAACCGTGGGACGTGGGGTCCGTGCGGGCGAGAGGG
CTGGGAGACGGGGGGGGGGGGCGGAAGGGGGGGGGGATGGGGAGTGAAGTCCCAACGGCGTCTGTCTTCCCTCTCGGTGCAGGTGACGCATGCAGCCTCCCGGACGGCGTGGACAACGGG
GGCGTCACGCTCTGTGGCGAGTCGGGGCAGCACGTGCTCGTGTTCTTCTGCCACCACGGGTTCCAGCTGCAAGGCCAGGAGCAGGTGGCCTGCTCCCCCAGGGGCGCGGATCTCCGGCCC
CCCGTCTGCAGAG
GTCAGTGGCTCCAGAGGCACAGGCTTTACTGACTTTACCCCCAAATCTGCCGTTTTCAAACAGGAAGTAAGAGCAAGTGCCATTCACGGAAAGGTGCCTCTGGGCGT
CATTATCTTCCCAGGAATTGCTTTGGCGTGGAATACGGTGTCCGTCCTAGGCTGACACACGCCCCAGCTGGCCTCTTTCTAGACAGTCACGTCACCGCATGGCCGTCACGGTGACCGGCA
GGGAAGGGGACGTGTGAGTGACTTTCATGAAGAGCTGCAACAGCCAATTCCTCAAATGAAACCAAAGAGAAACTCTTCCACTCGAAACAGCCTGGAATAGCTTGTCATCCAGCCACATCC
TCATCCCCCGTGTGCTGGGCCCCGTGCGCCTGGTGTGGACTTGCAGCCAGAACGCGAGCGCAGGTGGGAGAGCCTCCAGGGTCTGCCCCGGGTGCCCCGAGCCACCTCCCGCTCGCCTGC
CCCTCTCGCCTGCCCCGATACACTGCTTGGAACAGTGTCGGTGGCCGGTGCAGAGCTCAGGTGACTGGCCTGCGTCCCCAAGTCGCTCCTGCAGAGAAGAAGGCAGAAGGGACGTCCCAA
GGGGACGTCTGTGCATTGGACCCCGAGGCTGGGGATTCCTGGTGAGAGCAGCCCTGACTGCTTCAGAAATGACCCACAATTTCAGTGCACGACCCTGTCAGTGGGCACCAGGTGGTGGCC
AGGGAAGCGATGTTGGGAGATGGAAGCACGCGTGCCCGACTCCCCGGCCCACGGACCGTGGCCACAGAAGTCTGGGACAGGAGCCTGGTGTCAGGCGCCAAGCCGCATGCGGGCTGCTCG
TTACGAGCTGCGTGTCACTCTGCACAGGGAAGAGGGATGAACTCACGCACGAGTGTCCACGTAGGACGATGAGAACTCTGGGGATGGGTGGTGGTGATAGTTGCATATTAATGCCATCCA
AACGCACAGTTAAAAATGGTTCAGATGGTCGATTTTTTGTGATGTATATTTCTCCTCAGTAACAAAAATCCCCGTTTCAGTTTTGAATGTCAGGAACGTCCTGTCCTGGGAGGGCGATAG
GGCTCCCTGCTTCTGGCTTTAAATCCTACAGGAAGACTGAGCAAGACCATGAGCACCCAGTTTGCGACGGTGCAGTCCCGTGCACCTGCCAGGCTCGTGGCAGGGTCTGGGGGAGGGCGG
GTCGCCAGCTGCAGAACCAGGTCCGGGGAATGACCCTGAGAGACAGCCGATGACACAGAAACAACCAGGTCAGAGCCCGCCGGTGCCAGGGACTTTGGTGCTGAACACATGGCCACACTG
GAAAAGCTTTGCACCCAGATTTGCCCAAGCAGGCCGCGAGCGGCTGGGCTGGCAGACAGCCCGCACCTCGTTAGGGCCTGGTTGAGGACAGGGACACCTCCCAGAGAGCTCCATCAGAGA
TCTGCCTTCCAGAAAGTTCACCTTACAGGAACCCACAGTGCTGTGTGCCTCACACCCTTTTTGCCTAAATACCTGGACATTTGAGGTGTTGATCTTGGCTGTTTTCAGCATCCATGACAC
CAAAGCTCTATTCTTGACTTGCTTTCTCAGCCCACCCCTCATGCCTTTCCTCTTCCATAATCCCTCAAACCAACACTTAATCTCCCCCTGACATGGCGGCACAAGACCAGCTGGGCCCAG
CACATGCCCGGCTCCTGCTGACCACCAGCTGAGAGACCCGGCTCGGTCTGAGCCTGATGGGCGCTCCTGGGGGACTGCTGGGGGCGCGGCACGCCGTTTGGGCAGATTCCAGGCTCACGT
GTTGTGGCCGCAGAGGCAGCAGCTCCGGGACCCCCAGCGAGTCCTAGTCAGGACCTGCACGGTAACCAAGACTCTGGTTGGGCGGGGTGGGTCCAGGAAGGCTGGCCAACCCGCTCTAAC
TGGACCCTGTTCCCCACCGGCCCTGACCTGGTCTGCGCCCCCACACGCCTGGCCTGGGCCCCCTCAGGGCTTCTGTGTCTGCCTCCAAAACCCACAGCCACTGTGACTCCGCATTTGCAA
ACATTAGAGGGGGATGGTCCTCAGTCCCCTCACGGCTTCTCGGTCCAAATGAGTCAAATGTGCAGTGAAAGCACAGGGCACGGAGCCAACATGATGAACATTGTGCGTCATGAGGAGTGG
CTCGGATTCTGGCGCACGCACACGGCGAACGCATCTGAAAACACCCGCAGGGTGCCCGCTGCCGTGCGTGCTGCCCACGAGGCATCGTGGAGTAAAAACACACAGGAATGGGTTAACAGG
GACCCGCTTAGACTTTTATAAAAGCGGAGGAGACCATTTGTTTGTAAAATATTTGTAAATGTCTTCACGAAAACGATGACTCGTTAAACTTGGTTTCAGACTCGGCGCCGTGAGCCGGGA
TGAGGAAGGAGAGGGTGTTGACTCGTTGTCGTACAATGCTGTGCTTTGTCCTGATGCGTAATAATTAAGATGGGCTGCCTTTAAACAAAGCCCTGAAACCGAGGAGGAGCAGAGGATGGT
ATGAATGCACTGTTAACGGACACAAACGTTTTCCACCTGATCTGTGCCCGGCGCCGGGCCTTCTGAGATCGAGAATCACAAGGGGAGACAGACTCGTGAACGGTGCAGACGGAGCCCTTC
CCTCGTGGGGCGAAGCTGACGAGAGTGAGTGTAAGAGCCACCGCGGGTCCTCGGTGACACCGCAGCTCAGGCCGTGGCCACGGGAGGGGAAGCCGGGCTCACTGCAGGGTTAACGCACAG
ACCCCACGAGACACACGCTCTCCTCTTCACTCAAACCCTGCTCGTCCGCCGACTCACCCACAAGAGAGGCCGATGGAAAGAATTCTGGCAGATTAACTGTAATGAGTCTCTTTTGAGGCT
TTAAAGTTGGGAATTCAAAGTGGTAGAAAGTGGGGTGTCTGTGGCCCTTTGCTCCTTGTTTCCAAGAGGGCGTGCGACGGATGAACACAGCCATGGCTCTTGTGTCCCCCGGACAGTGAG
GCCCCGGCCAGCACCCTGTGCGCAGGGGTGGGAGACAACGCGGGGCAGGTAAGCGAGCCTGGCCTCACACGGATCGACCCAGGAATCTGGGGACTCGGCGGGCCTGAGACCCGTGTGGGT
CTGTCCCCACTTACCCTGCAGCTTCCCCGGGCAGGGAGACCAGAAAGTATGGGGTCACTGACTTGGGTGAAGCGTGTCCCCTGAAAGGCACACAGTGGTCCTGACCCCCAGCTCTTTGAA
GGTGCATAATTACATCCATTTACATGTGGGGGAAGTCTGTCTTGGGGCAGCCCTCAGCCTTGGCCTCCGCGTCAGGACCAACCCCGCCCTGCACCCCCATGTGCACTTGCCCTGTGGACA
ACGCCCGGGACTTACGTTTGTCACGCGGCTCTGGTCAGGCTCCAAGTCCCCCACCCGCGCCCTGGGAGGCGAGCATCACTCCGTGTCCGGACGCCGGCCTGTGCGGGGGTCCAGCCTCTA
CCTGGCAAGTCCCCATGCGCCCTGTCCCCACATCGCCCCGGAGTGTTGGCGGCACAGGGTCCGGGATGAAGGCAAGGGGGCCAAGCTTCTTTCACGTCATTCCCCGAACACCGACAGCCT
GGGAGAGTGTGATGGTGTGTGTTGCATTTATTCAACACGTGCTCAGTGATACGTAACACACGTTGTCTGTTGACACTAAGACCACCTGTGTTTCCTGGAACTGGCTGGAAAAGAAACATT
ATTTGAAGAAAAATGAACACAAGTCACCTGGAAACAGGCCCCGGAAATCCAGCAAGGGGTTCCAGGTTTCTGGCAGAAGGAGACGTGAGGGCAGCACCCCTTCCTCACTGACGGTGGCTC
GCCCACGCATACCAGCTCGCTGGGCCTGAGAGCCCAGGCTCTGACTCAGGGCTGGGCAGCCAGTGCTGCCCCAGTGGGTCAGCGTCAAGGGTCGTGGTGTCATGACCCAAGGCCTCGCAT
GCTCTCTGAGGGTGAGCCGTCTAGAGGGTGCACAGACCCAGCCCTGCCCTGCTCACCTGCATCCCACCCGCTCCTGTCCCACAGCAGGCCGGGTCCTACTCGGGGTGGAGGGGGCCGGCA
TCCACGGGAGCCTCTGACTCCATGTCTGACGAGGCACAGCAGGCCCGTGTGCTGCGAGCCACCGGTGACTCCACGGGGCACCCCGGCCGTGCCCTAGCCGTGGTCCCACTGGCTCCCCTC
CTGCTCAAGCAGGAGCACTTGGCACAGAGCTTGAACGGAAGTGAGCCATCGGCCGGGAGGGACTGGACCAGCATCGCTGTGCGCGGGGTCTCCCGCACAGCCTCATGGTCACACCATGCT
GCGTGGTCACAAAGGGGCCGACCGTCTGCCAAGCTGACCTCAGAGGACATGCACTGGCCAGGAGAAAGCGGGTGCTCAGGGAGAGGCATGGCACAACAGGGACACGGCTGACTGGCCACG
GGGGGTTCTCGGATTCTCTTGCCCACAGTGCAGGGAGCGTGCGGGTGTCTCCAGGGTGAGGACCAGAGTGGGCGACGGGGAGGATGGGGACGTTGCCTGACCTCCATGTGGTTTGTGCAG

ATATCAATGAGTGTGAAGACGTGACACCCCCTCCCTGCCACCCGTCGGCCCGGTGTAGGAACACCAAGGGCAGCTTCAGGTGCGAGTGCACAGACCCCTACGTGCTGGGGGAGGACGGAA
CGACGTGTGTAG
GTGAGTGCACACTCCTCATGCTTCCTGAGCAGGGAGGGGAGGGCAGGTCTGCGGTCCAGCCTACAGATGGCAGCAGGGTCAATCTCCCAGCTGCACTGCGCCCGTGAC
CATGAGCGTCCTGCTGCCATCGTGCGTGGATGCAAGTGACAGCACCACGTGTGTCCCGCTGCTGTCACGTGTGGACGTGAGTGACAGGGCCATGTGTATCATGCAGCCGTCATGCGTAGA
CATGAGTGTCAGGGCCATGTGTGTCCCGCTGCTGTCATGCATAGACGTGAGTGACAGGGCCACATGTGTCCTGCAGCCGTCATGCGTAGACGTGAGTGACACGGCCACGTGTGTCCCGCT
GCTGTCACGCGTGGACGTGAGTGACATGGCCATGTGTATCCTGCAGCCGTCATGCGTAGACATGAGTGTCAGGGCCATGTGTGTCCCGCTGCTGTCATGCATAGACGTGAGTGACAGGGC
CACATGTGTCCTGCAGCCGTCATGCGTAGACGTGAGTGACAGGGCCACGTGTGTCCCGCTGCTGTCACGCGTGGACGTGAGTGACAGGGCCACGTGTGTCCCGCTGCTGTCACGCGTGGA
TGTGAGTGACGGGGCTGCACCAGTATGTGATTGTTGGTGGCCTGCTGCGTGTGCCCCTGGCCGTGGGCTTCACCCCGTGTCCTCCTCACAAGCTTTCCCTCTGCCCCTGGCCATGGTGCC
TCCTCCTGGGGAAGCCTCTGGCCTTATTCAGTTTTCCTCTGTTTGAACATTTGTTCTCCATGGATCTGATACCAGAACACTCTGGGTCACAGAAAACTACAAAAACAGCAGCTCTCGCTT
TCAGGGTTTTCAGGAAAATGTCTAAAACCGCCATCTGAAGGCCGCCTGGTCAGGTGCCCATGCCGCACACACACCCAGGAAGGGGGTCAGGGCTGTTCCAGGCCTGGGATCTCAGGTCTG
GGACCTTCAGGGCGAGCCGAGGGCCCAGGGTCAGCAGTCCCGTGTCTCCCCGGGAAGACTTTCTGTGCTTCTGTAGCACCTACTTCTGCAAAGTGGGGGGCGCCCCCGCTATGCCTTCCT
TGTGGACGTTTACTCTGGACCTCATCCCCGCCCCCCGAATGATCCTGGTCGCAGAAAGGTGAGATTTTGTGCAGGGCACACCCTGAAGCTGCACAGGTTCGGTAGAGGCTGAGGCATCTT
TTCAGGAAACAGTGACTCTTACTGGGGTCTTTGCACGTGGTCACCCCGTCCTGGGTGGGTCGGGGCACGGCGCAGCCATCTGTCTGCTGGAGGTATCGCCAGCTTGCATCCCGTTGCCCG
TCCCCCCGTCCCTGCGTCCACGACCACTGGGGTCACGAGCAGCCTGGGAACAGTGTCTGGAGACGAACCAGGGCCCAGCTGGCTCTGGTTGTCTTTGGTTTTGAGTCTTGGGACAAAAGG
CTCTGCGTTCTGTTGGGGTCACAGCACTGCACACCCAGCTGGACCACACAGCAGACCTGTCGTCCTGGTCCTGGGGCTAAGTCTGAGGTCCAGGCGTGGACAGCGCTGTTCCTCTCGAGG
ACCCTCTCCCGTGTCCTCACCTGGTCGTCCTTTCTCACAGGACTCCAGTCACTGAGATGGGGGCCCAGCCTTGTGGCCTCATTTGACTCCGGTTACCTCCTCAGGCCCATCTCTGTACAG
CCACAGGGAGGCTGGGTGGACATCAGGCCAGTGGGGCGGAGAGAGGGGAGGGTCATTCCAGGCACCAGACAGGCGCAGGCTGAGCCGGCTTGGGCGTCGTGTAGTCCGCCGAGGGGTCCC
CACTCCCACTCCGTCCACCTTCCGGGGCAGGGGCAGCTCTCTGAACGGCACACACCTGCCATCTGGGAGCTGGCTCGATGTAGGCAACAGGCCACGGACCACGGTGGGCATGTCTGTGAA
GTTCACTCTTTATAGTTTTGGAAGAATCTGTGCAAGGCAAGTCTCTCGTGGGTGTCCTCTCTGCCCGCACTCTGGACGACACCCAGGCGGCCGTGCTCACCATGGGGCCTCTTTTATGCC
GGCTGACAGTATTTAACCTTTTATTTGAAAGCGGATTTCCCTACCTCCTGTATTTCTACTTGGCCCGTAGTGACCCCAGCAGACCTGGAATGGGCACATGTGTAGGCATGGGACTTGCAC
CCACACAGAGGAGCCCGTGGTGCACGGAGATCCCAAAGCCCTCTCTTCGTGGGTGGGCACATCCTCGGCAGGTGGTGGGACCCAGAACAGGACGGGGCTGGAGAAGCCGCCTATTCTATC
CCTGCTTTCTGGGTTGAGGAGGTCGAGGTCGGGTGTCGCACAGGCACTCCCAAGTTCCATCACTGAAACCCCACATGTCCCAGGCCTCTACAGGCAGCCTCCTTCCTTGGCCTCACCCCC
GTCCAGCCACGGCCCCTTCTGGTCTGTACCTGCCAGCCCTGCTCATTTCTCCCAGTCGAGCCTATAGCTGGGACCCCTGCTGTGTTTTGTCCCCCACGGCTTCCCCACAGGGTTCTGACC
ATTGCCCAGACAGGTGCCCAGACAGTTTACCCTCTACCCACTTCTGCAAAAAGCAGGGTTGCCAAGGGCACGAGCTCATGGTGTCACATGGCACCTCCAACCACCATTGGCCCCTCTCTA
AGCCCAGCAGAGGCAGACCAGGTCCCCAACACCTCTGCATGGGGCTTGCTCGTCTCTCCTGGCCAGTCCTCGAGGGAGGGCCTGTGGCCTGAGAAAGGGCAGGCACCCCTGTGCTCTCCC
CCAGCTCTCCCACACCTCACGTTCAGGAGAGCGCATCTGCTGAAATGGCTGCTTTGGGCAGGGCGGGCTGGGGCTTGCAGGGCACGCTGGCAGCAGCCCTTGGCAGGGGCTCACTAACCC
TCTCCTTCTCCCCAGACTCTGGGAGGCTCCCGAAGGCGTCCTTGGTCTCCATCGCGTTGGGCGCCCTGCTGGTTGGTGGCCTGGCAGGTCTCACCTGGACGGTGATTTGCAGGTGGTAAG
TCCTTCCTCTGAAGCTGGCACGGGGGTGTCTGCTCCCCCGTGGGCAAGGCTGGTGTGTTTCAGAGGCCAGTGCGGATGCTTCGTGCCCTAAGCCCCTCCAGCCCCAGAGCGAGTTTGTAC
GAAGCCTTAGATTAGACTCCTGGGTCTGTGTTATGCTTTAAGTAATGAAGGGGGAGCAGTGGCCTGCACACCTTGGGGTGTCAGCTGACTGTGAATGGAGACTCTCGGGCAGGGACGCTC
GGTAACGCCACCGGTTGCATGAGATGCTCTCATTAGAAGCAGAGATTCTCACAGAGTTTTCTAGGAGAATGAAGGTCATCCCTGGATAAAAAACCAATTCTTCGGCTGCACCCCCCAGGG
AAATTGGGAACTTGAAAGTTGGACTTTTATGTTAAAAATGGCAGCACAGAGTGTCTCTGCGGCCGACGGGTCCACTCACCTGAGCAGCGGCTCTGAGGAATCAAGCTCAGAGTCTTGCTG
AATTTTCTCGTGGACATAAACTACAAGAAGCCATCGCTGGTCTTGTCTGGCCAGGGCACCCCCACCCCGCCGCAGAGCGTCTGCCCAGACACTGCTGCCACTGCCCCACGGAGCTCCGCG
GAGCCCTTTCCCTCTGCCGCGCCTGCTCCCCGGCCGCCTCCCACAGTCCCATCCCCCTGTCCCTCTGCAGCAGTGGCGCTGCGGCATGCCAGACCTCAGCCCTGGTGGTCAGGTCTCACC
ACTGGGAGGTCACTGTCGCGTTCCAAGGGCGTCCCCAGCCACTGCCCACTGTAGCCTGGCTCCTATCCGAGTACCTGGGGGGTAGCGTCCCCGGACCCATGACTGCGCCGCTCTGCCTGC
CTGCACGCCGCGTCTCGATAGTAAAGCCAGCACCCGTTTCCTTTAAACCCCAAGACCGCCTCTACCTGCACTTCTTTACCTGACACGTGAGTTTGCCATCTGTCGGGTAAAGGGTATTTG
AATGACACACTCGGAACAGATCCGTAACTTCTGGCAGAGCAATGGCCCACACCGGGAGGAATTGCTTCCGACCCAGCAGTGTGTCTCGCGGGCTAGGTGAATCCAGCCATGATGTCGTTA
CACTCTTCTGTCGATCGTGTGAGGTCTTTGTTACAGGCTGAAATGCGTTCCCCAAATTCACAGGTTGAAGACCCGACCTCTGGTACCTTGGCATGTGACCATATTTGGAAGCAGGGTTGT
TGGGGACATAATGAGTTGAGATGAGATTGTGTGGGAGTAGGTGTCCCCAGTCCAGCAGGACTGCTATCCTCAGGGGCACACACAGAGCAAAGGCCAGGTGAAGATCAGAGCAGAGACCAG
GGGTGTGCCTACAGGCCAGGGGTGGCCAGCGAACCCCCGGAAGGAGCAGCCCTCCCCGACATTATGATCCCACATGTCCATGCTGTGGAAGGGGGAGAACAGATTTCCATGGCCAAGCCC
GCGGGGCCCCGGTATCATGTTACTCAAGCCCCAGGAATCACATACAGCAGTGTTGGGGTGTCTGTTTGCAGAACATCTCGCTTGCCCACCCTGATAAGAGCTGGAGTAGATTTGAGAACC
AAGTTCTACCCAGGTCTAGGGGTCTGGGCTTGGCCGCCGCACCCCCGGCCTCCTCCCAGTTTGCTTTGGACCGAGCGTGATCACACCATCAGGGCTGTCACCGTCAGGCCGGTCACCATC
CACTGTCATTCCTGCAAACCACTGACCAGTCATCACTTACATCCTCTTCAAGGCACCACTGCTGACCTGTCACGGAGATTATGTCTACTAACGTTTAAACAGCATCTCTAGTTTTAGGTG
GGGCTGGCGGCAGGAAATCGTCCCCGTTTTAGGGATCGCCTGGTCTTAGAAGCTTAGACATTGGCAGTAGTTAAGACCCATAGCCGGTCACCAAATGAACAAAGCAGTAAGAATGAGACT
GTCGGCGCACACGCCCGGGTTCTGCGATCCCGTGGACTGAATGTCCACTCTGTGAAAATCTGACATGACCACAACTTAGTGTTCACGCACAACTCTGTGTTTGTAAACGCCTCTGTTAGA
CATCAGTCACCTTGTCATTACGCAAAGGTTGTGCCTCCAGCCCCCACACACCAGGAAAACAGATGTTGACAGCCATGCGTCAAGTGAATACATTCCCAGGAAATTTGGGAGAAAGTGTCC
ATCATACTGGAGCCTTCGTACGCGCCCCCACGCACCGCTTTGCTGGTCAGGAAGTGGCAGGAGGGGTGCAGACCCTTTGGGCCACAGAGACGCTCGGAGGGGCGTGAGCAGGTGTGATTG
ACTTGCCAGAGTTGCTGGCCCGCGGCCTCTGTGGGGACCAGATGGACAGCAGGACAGCACCTAAGTCCCCAGGGAGCTCAAACCTGCAGCCACGTCCAGAAGCGCCCTCTCCGGGCTCCA
GATCCTCTCCCCTCCCCTCCCCTCCCCTCCGCTCCCCACAACAAAAGGCCTTTCATCTTGTATTTGAAACTGCTTTGGTTGAGAATTTGAAACTTCCTGGGTTTGGGTCCTCCCAGGGAG
AGAGGGAAGCTTGGAAAGGGAGGGAGCTTGTCCTTTGGGATTGAAAGGGCACAGCGCGCAACCAGAGGGGGCTTCGCGCCATGTGGGCCGATCCGAGGAACTGCCGTCTGCGGTGGCTCT
CACCGCCCGTTGGTGGGGGCTCACCCGGGCCACTTGCCACTCCGTGTCCACACCGGCAACTCCGCGTCCACAATCCATAAACACCCTGGCATCTGGGCACCGCGCCCAGCCCTTCACCGC
GAGGCTGCATGGCTTCATCCAAAAGCACGTCCAGCCGGTTGTGCGTATGAGTGAGTGTTGCACTTGGCCGGATGCTGGGACAGCACCTGGGGCCCCTCCTCCCTCCTGGCCTCTGCTCTA
CACGGCTTCCCAGGGGGTTTATGTGTGGGGCCTCCCCCCCCCTCCAGCCGGGCTGGGGCTCCGAAGCCCCGAGGCTCCCTCTCCATACCTCAGTCCACTCGGCTCTCCAAGGTCTGGGTG
CAGGGAACACAGCAGGAACGAGTGCCCAGCCCTGCTCCCCAGAGCTGTCCTTCCAGGAGACCAGACGCCCTCACACGCGGTACCGCAGGAAAGGGTGGCCCCTCAAAGCGTGTTTCTACC
GTGCCCTGAGTCCGCGAGACGTGGAAGCAACCACAGGAATGATGGGGTGTCCCGCGATGCACATGGCAGTGTGAGGGGACGTGTCCTGACTGTCCTGCTGAGCCCGTGTCACTTGAGCAA
CGCTGCCTTCCTCCCGGGATGGACGTTACTCTGCAAACTCACCCTCAGCTCCCGGTGACGCGCCCATCGACGAGGAGGCTGGGCTTGGACCCGCATTCGCAGCCTCATGCTTCTCCCGGC
ACCCCTGGCTCTCTGCGAACTCGCTTCCTGCCTCCCGCCCCACATCAGCCCCACTCATGGTCTCGTCCCCGAGTCCCTGGGGCAGGACCCACGATCCAGCGGCCCTGCTTGCTCCTCACG
GGACACGCTTGAATCATAATTCCATGACAAACACGAAAGAGAATGAAGAAGGAAAAGGCTATGTTAACAAAATGCTTTGTGTGGTTTTTTCCTGAAAGCCTGTTTGTGAGGTCCCCTGTC
CGGAGTACATACAGCCCTACGAAGATCGGGCGGGGTTGCTGTGTCTCATGTTAGCTGTGGTTGTCCCTGTATCTCGGGACACGCTGCTGAAGGAGCCCCACATCTCCCCACTCCTTGTGT
TTTGGAAAGAGTCTGATCAAACTCATGGCAGTGACACAGCGGCCCCGCCGCTTCCATCCATCGCCCGCGGGCCGAGATGGAAATGGATGTAGAAACCCACCAAATACTCCAACGGAGAGA
CGCTCCCTCCCAAATGCGGTACGCAGGGTTTTCAGGTTTGCTTTCTACACCAGGATGTCTATTTGCATGTCTGCGAATTTCTCCGTCTTTGCGGAGAGACAGAGCTGGTGCCCAGGGGAA
TGGCTGTCCCACGGCAACGTGACCAGACTCCCTCCTGGATTGTCCCGTCCTCCGGGCAGCGGCCACGAGCGAGGCTTTGACCTCCCAGAGCACCGAGGTCTGCTAGGAACTGGGCCACAG
CTGTGTCCATGTCACACGGTTGCTGTAAAGATGCCTGACGATGTGAACAGGGCACTGGCTCTGACCATCATCAGAAGCAGGTCCCTGCTGCGGGAGGCGCGAGTGTTCTGTGCACGCGTG
CACATGCACACACACGCACATGCGTGTTCCTGTTCCGAGCTGACTGCAGTGAGCTTCTCACGGAAATGGCCGACTGAATGGAAAGCACCTGCCGCCCTGTCTCGATGCCCTCGGTCCCCC
GAGCGCCCAGCACCGTGTTAGACAGGATGGATCACGGCACTCAGGGCTCCAGGGGAAACGGCAGAAAATCAACAAAAAGACAAAAACCAAAGGATGACCTACTGTGAGCTGTGCTCTGAT
GGCTGTTGGGGCAGGCACTGGCAGGAGGGCGCCTGGGGGGCGGTCGCTGAGGCCCCTCGGGGAGGACATGAGGCTCAGACAGAAACTGCCCGGTGCCTGTGCCTGTGAGTCCCAGACGGA
GGGGACAGAAATCCAGGGCCCGCTTTCCAGAGAGCGCGGCCCCTTCCAGGAGGATGGTGGCCACGTGCCGGGCTCTGCTGTCCTGGATCTGTGGCGGACACGGGGTGTCGGCCCCAAGGA
GAGCTCGGCGTCACCGCTCACGGCCTCAGGCGGGGGTGGAGGTGGGGGTGAGACGGAGGTTAAACCGCACCCGGGGAGACCTCTCTGCTCCGGTCTCCCTGTCCTTCCTCCTGCAACTCG
AGCTCCGCTGGTCCTTTCTTCCCCTCCGCCGGCTGTGAAGGTACGTGGCTCACCCGAGGTCTTTCTTCCTTCCCACGTGGGAGCATATCACCGGAACATCCCCTCTGCGTGCGGCGTTCT
CTGTGTCCGTGGGTCCCAGTGCATCCTGCCCGCTTCCATTCCTCCCGTGACATTTCCTGATTTCCCTGTGACTTGCCTGGGGCCCTGGTCGTCCGGAAGGGTGTTGTTCACACCCTGGGA
CCCCCGGCTTTGTGCGGGTCTGTCGAGGAGGGGCCGCAGCCCTGACCGGCTCCAGCAGGAGAGGGCACAGTGTGCTTCTGAGATGTTCATGGCTCAGGAAACCTACATCCAGACGCAGTG
TCTGCAGTGAGCCTGGGAAACAGAAGACAGAAAACGGGAGTGGGGGGCCTGCCCGCAGTGCACTTTCTTCCCCCCGGGGACTGCAAGTTTCCGAATGCATTTCTGCACGAATCCGAAGTA
TGATCAGATGAGTTTGGCAGGACTGGGGCTGGGAGTGGCTGCTGGCCAGGGCGTTTGTGGGCTGCGGCCGGGGTTCCTGGCGCTGGACCAGCTCCGTGGCCTCCTGACACCACCCCCCAT
TCGATGGAGGAGAACAGTGCGGGCCATGCTGCACCTTAAAGCTCTCCTCACAGTAGTAGCGGCCCCCAGCTCCTCCCCTGACGGATTCGGGAGGCACTGGTGTTCCAATGCCCCCTCCGG
TCACAGTGGCAACGTGACAATGTGTGTGACAGGCTCTGGGGGGTTCTCCTGAGTTGTGACCACCGTAACCAGGTGTGTGCTTGTCCGCAGGACGCACGCAGGCCGTAAAGCCTCACTGCA
CATCAGAGACACAGGTGGAAGAGGCACCTGCCAGCCAGGTCGTGGAACACGCCGGGACATGAGTGTGTCAAGCCTGGTGCCCCTGCTCGGGGCGCAGGGCAG
GTGGGTGCATGCCTGAGC
AAGCACAGGCTCGCCACAGGTCACGTGTTCCCATTCAGACCGAGAGGCCATCACGAAGAGCCCGGTCCCATGCTACCCACTGCTGGTTCTGTCCCGCTGTGCACACACCTGCTGGGCATT
TATTGGTCACGAAAACTGTGTTTATGCAAGAGGATAATTTGTGGAAATTTTAACCTGCTTTTTAAGAAGTGTAGATTGGGCGCCTGGGTGGCTCAGTCGTTGAGCGTCTGTCTTTGGCTC
AGGGCGTGATCCCAGAGTCCTGGGATCAAGCCCCACATCAGGCTCCTCCGCTATGAGCCTGCTGCTTCCTCTCCCACTCCCCCTGCTTGTGTTCCCTCTCTCGCTGGCTGTCTCCCTCTC
TGTCAGGTAAATAAATAAAATCTTTTAAAAAAAACCAAATAAACAAAACAGCAAACCAAAAAAACAAAAAATAAAAAGTGTAGACAAATTAGAACAAGTAAGCCAGAGAAAGAGCCATGA
CAGTGCTTTCCGTTCATACACACCAGATCGAAACTGACAGCCAAGGGCAGGCGTTCAGCTCATTATTACCCCAGATCTTGGCCGAAGAAGACAGCCAGAAGCTGAAAGGAAATGTGGATT
TCTAAAATACACTTAAAAAAAAAAATGAGTTGAGACAACTGGTCTAGACTTGCGTGTTATTATTTTTACTTTGTATGCATGACCACAAGAGATGCAGCGGTAAAGTCAGCGCGTGTCTGC
GCGTGTCCAGGATGTAGGCAGTCAGCCGGCCCTGGGACGTTTGAAGCTGGCTGTCCCCTGAGGTGTCCCGCCACAGAGCAGGGTCCGCGTTTGCACCCAGGCAGGGAACCTGAAACACCC
CTGTTGGAATGCACATGCGAGGCCCCTTCCAGCCACCCTGAGATCCGCGTGTCCCCAGGCCCCAGAGGGTGTCCCGTCTGTCCGTGGGCTCAAAGCCACTTCTCTCCTGCAGGACCCGGC
CTGTGGATCCCAAATCCTTCTCTGCCAGTAGGAGCCACAGTGGTGCACGTGGAAGCTGGGCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGTGCTCGCGGTCCTGGGCGTCACGCTGGTGGCGGCCTGCACACATGGCTTCTTGCCCTTCTTCCTGAGAGGCAAGGACCTCCTGTGGGGACGGGACGGAGACTCTCCTGTCATC
AGCGTCGTGGAAGAGAGCAGGCGCATGGTGGACAGCGCCATCTACCATACCATGAGGAG
AGACCTCAGCAAAAGAGAGATCCCATCTCCATCACGGCTTCTGTCTTTCTCCAAACTCCCT
GAGCCAACCAGTCGAGCCGTCTCCCGAGCGGCCGAGATCATGGAAGCTTCCGTGCGGGCCCTGAAGACAAGAGTCTACGGGAAGCNNNNNNGCCACCCACCGGTGAGCCCCCGAG
ATGTC
CTGCCGGAAGATGTGCTGAACACAATTGCGAATGTGTCCGGATGCCTGCCTTACATGCTGCCCCCTGGATGTCCGAACACCTGCCTGGCCAGCAAGTACAGGCTCATCACGGGCGCCTGC
AACAGCAG
AGACCACCCCAGGTGGGGAGCCGCCAACACAGCCCTGGCGAGATGGCTGCCGCCCGCCTACGAAGACGGCGTCAGTGAGCCCAGAGGGTGGAACCCCCACTTCCTGTACAAC
GGCTTCCCACTGCCCCCG
GTCCGGGAGGTGACAAGACAAGTCATCCAGGTCCCCAACGAGGCCGTCACAGAGGATGACCAATATTCTGACCTCCTGATGGTGTGGGGGCAGTATATCGAT
CACGACATTGCGTTCACACCTCAGACTACTAGCAAAGCTGCATTTGGGGGAGGAGCTGACTGCCAGCTGACCTGTGAAAACCAAAACCCATGTTTTCCCATACAG
CTGCCCGCCAATGCC
TCAGGGACCGCGGGGGGCGCATGTTTGCCGTTTTACCGCTCCTCTGCCGCCTGTGGCACCGGGATCCAAGGCGCCTTCTTTGGCAACGTGACCTCGGCCAACCCGCGACAACAGATGAAC
GGGCTGACCTCTTTCCTGGACGCGTCCACGGTGTACGGCAGCTCCCCGGCCTTGGAGAAGCAACTGCGCAACTGGACCAGTGCCGAGGGGCTGCTCCGGGTCAACACGCGCCACTGGGAC
GCCGGCCGCGCCTACCTGCCCTTCACACGGCCTCCTGCACCCACAGCCTGCGTGCCTGAGCCCGGCACCCACGGGACGGCCGGGGCACCCTGCTTCCTGGCAGGGGATGGCCGAGCCAGC
GAGGTCCCCGCTCTGACGGCCGTGCACACGCTGTGGCTGCGTGAGCACAACCGCCTGGCCTCCGCGCTCAAGGCTCTCAACGCTCACTGGAGCGCCGACACGGCCTACCAGGAGGCGCGC
AAGGTGGTGGGCGCCCTGCACCAG
ATCATCACCATGCGAGACTATGTCCCCAAAGTCCTGGGCCCTGAGGCCTTCCAGCAACACGTGGGCCCCTATGGGGGCTACGACCCTGGCGTGGAC
CCCACCGTGTCCAACGTGTTTTCCACGGCTGCCTTCCGCTTTGGCCACGCCACAGTGCACCCACTGGTGAGGCGGCTGGACGCCCGCTTCCAGGAGCACCCTGCCCTCCCCCCGTTGCGG
CTGCAGGACGCCTTCTTCAGCCCCTGGAGGCTCCTCAAGGAAG
GTGGTGTGGACCCCCTGGTGAGGGGCCTTCTCGCGAGACCAGCCAAACTGCAGGTGCAGGACCAGCTGATGAATGAG
GAGCTGACAGAGAGGCTGTTCGTGCTGGGGAGCTCGGGCAGGCTGGACCTGGCATCGATTAACCTGCAGCGGGGCCGGGACCACGGCCTGCCAG
GCTACAACGCATGGAGGGAGTTCTGC
GGCCTGCCCAGACTGGAGACGCGGGCCGACCTGCGCTCTGCCGTCACCAATGCGAGCATCGCGGGCCGCATAATGGACCTGTACGGGCACCCTGACAACATCGATGTCTGGCTGGGCGGC
CTAGCCGAGACCTTCCTGCCCCAGGCGCGCACGGGTCCGCTGTTTGCGTGCCTCATTGGGAAACAGATGAAGGCCCTGAGGGACGGAGACCG
GTTCTGGTGGGAGAGCAGTGGAGTGTTC
ACCGAGGCCCAACGGCGCGAGCTGGCGAGGCATTCCCTATCCCGGGTCATCTGTGACAACACGGGCCTCCCCAGCGTGCCCGCAGACGCCTTCCAAATCGGGAGATTCCCGCAGGACTTT
GAGTCATGTGAGAACATTCCGGGTCTGAACCTGGACATGTGGAGGGAAGCCCTTCCTCAAG
GTGACGCATGCAGCCTCCCGGACGGCGTGGACAACGGGGGCGTCACGCTCTGTGGCGAG
TCGGGGCAGCACGTGCTCGTGTTCTTCTGCCACCACGGGTTCCAGCTGCAAGGCCAGGAGCAGGTGGCCTGCTCCCCCAGGGGCGCGGATCTCCGGCCCCCCGTCTGCAGAG
ATATCAAT
GAGTGTGAAGACGTGACACCCCCTCCCTGCCACCCGTCGGCCCGGTGTAGGAACACCAAGGGCAGCTTCAGGTGCGAGTGCACAGACCCCTACGTGCTGGGGGAGGACGGAACGACGTGT
GTAG
ACTCTGGGAGGCTCCCGAAGGCGTCCTTGGTCTCCATCGCGTTGGGCGCCCTGCTGGTTGGTGGCCTGGCAGGTCTCACCTGGACGGTGATTTGCAGGTGGACGCACGCAGGCCGT
AAAGCCTCACTGCACATCAGAGACACAGGTGGAAGAGGCACCTGCCAGCCAGGTCGTGGAACACGCCGGGACATGAGTGTGTCAAGCCTGGTGCCCCTGCTCGGGGCGCAGGGCAG
GACC
CGGCCTGTGGATCCCAAATCCTTCTCTGCCAGTAGGAGCCACAGTGGTGCACGTGGAAGCTGGGCATGA

Retrieve as FASTA