Entry information : PpaPrx[P]13
Entry ID 7981
Creation 2011-02-07 (Toky Ramarohetra)
Last sequence changes 2012-01-05 (Toky Ramarohetra)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-07-03 (Qiang Li)
Peroxidase information: PpaPrx[P]13
Name PpaPrx[P]13
Class Class III peroxidase     [Orthogroup: Prx040]*
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaPrx[P]13
start..stop
S start..stop
PpaPrx53 500 1e-180 1..308 1..336
PpaPrx13 500 1e-180 1..308 1..336
PpaPrx43 444 2e-158 1..308 1..335
PpaPrx07 206 5e-65 17..307 13..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 659683..659937 255 N° 2 660135..660290 156 N° 3 660319..660830 512  
join(659683..659937,660135..660290,660319..660830)


exon

Literature and cross-references PpaPrx[P]13
DNA ref. Phytozome 12:   scaffold_232 (659683..660830)
Protein sequence: PpaPrx[P]13
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   306 (274)
PWM (Da):   %s   32780.21 (29439.6)  
PI (pH):   %s   4.9 (5.03) Peptide Signal:   %s   cut: 33 range:33-306
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASNPMGPSTMQVLRMTVAVAMFFLSGEVDATSYNLLRPNYY*GKCGKYDVESVIYYAIAKAFQQDNGVAPGVVRLAFHDCFVRGYDASLLLDISNSEKNATINLGLRASAFNAIDAAEAAVESVCSEIVYGGLKDPPPPPNNLPVPTMTPAQMIPIFAGKGLSADDLVALSGGHTIGIAHCAFVNPRIYGNNTDPTIPADFLTSLKSQYPADSVTTNPPIGAPIDLDRV*ATQFHSQYFQNIIDREGLLTSDKSHLDDSRTSQAVYKNKGNFFNWEFGWAMQAMAGIGLLTGDExQIRTNCRALNP

Retrieve as FASTA  
Remarks In-frame stop codons, sequence shift.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCTTCTAATCCGATGGGTCCATCAACAATGCAAGTTTTGCGGATGACGGTGGCCGTTGCCATGTTCTTCCTGAGCGGCGAAGTGGACGCTACTTCATACAACCTGCTTCGACCG
AATTATTACTAGGGCAAGTGCGGCAAATATGATGTCGAATCGGTCATTTACTATGCCATTGCAAAGGCATTTCAACAGGACAATGGAGTCGCCCCCGGCGTTGTGAGGCTGGCCTTCCAT
GATTGTTTCGTTCGT
GTAAGTGTGGACTCTCCCTTCGTCCAGTGCTTGTGTAGCTAGTTTGTGTAGGCTTCGTCAATGTGCTTGCGTCTTGACGAGTTTACGGGTACACGTTTTGAGGAT
CATGTCATGTCTGGAATGGTGTGGTTTTGCACCGAAATTACTTTTCAGAGAGTGAGGATCCATCTGAAGTTGGACGTTGCTCTTCCTTCCAGGGCTATGACGCCTCATTGCTGCTTGACA
TATCCAATTCTGAGAAGAATGCAACCATTAACCTAGGGCTTCGGGCGAGCGCTTTCAACGCAATCGACGCTGCCGAAGCCGCCGTGGAAAGTGTTTGTTCAGAGATTGTGTATGGCGGTC
TAAAAGAC
GGAACTGTGTCCAACTCTGCCGACCACCCCCCCCCCCCCCCCAAACAACCTGCCAGTGCCAACAATGACGCCAGCTCAGATGATTCCTATTTTCGCAGGCAAGGGACTGAGC
GCCGATGATTTGGTGGCTTTGTCAGGCGGTCACACCATCGGAATTGCTCACTGCGCTTTCGTGAACCCTCGCATCTACGGGAACAACACGGATCCTACGATTCCAGCCGACTTCTTGACG
TCGTTGAAGAGTCAGTACCCTGCGGATTCTGTCACTACTAACCCACCCATTGGAGCCCCGATCGACCTCGACCGGGTTTGAGCAACCCAGTTCCACTCGCAGTATTTCCAGAACATTATC
GACAGGGAGGGCTTGCTTACATCCGACAAAAGTCATCTGGACGATTCCAGAACCAGTCAAGCCGTATACAAGAACAAAGGGAATTTCTTCAATTGGGAATTCGGATGGGCCATGCAAGCC
ATGGCTGGAATCGGTTTACTCACTGGCGATGAAGGNCAAATCCGCACCAATTGTCGGGCTCTTAACCC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCTTCTAATCCGATGGGTCCATCAACAATGCAAGTTTTGCGGATGACGGTGGCCGTTGCCATGTTCTTCCTGAGCGGCGAAGTGGACGCTACTTCATACAACCTGCTTCGACCG
AATTATTACTAGGGCAAGTGCGGCAAATATGATGTCGAATCGGTCATTTACTATGCCATTGCAAAGGCATTTCAACAGGACAATGGAGTCGCCCCCGGCGTTGTGAGGCTGGCCTTCCAT
GATTGTTTCGTTCGT
GGCTATGACGCCTCATTGCTGCTTGACATATCCAATTCTGAGAAGAATGCAACCATTAACCTAGGGCTTCGGGCGAGCGCTTTCAACGCAATCGACGCTGCCGAA
GCCGCCGTGGAAAGTGTTTGTTCAGAGATTGTGTATGGCGGTCTAAAAGAC
CCCCCCCCCCCCCCAAACAACCTGCCAGTGCCAACAATGACGCCAGCTCAGATGATTCCTATTTTCGCA
GGCAAGGGACTGAGCGCCGATGATTTGGTGGCTTTGTCAGGCGGTCACACCATCGGAATTGCTCACTGCGCTTTCGTGAACCCTCGCATCTACGGGAACAACACGGATCCTACGATTCCA
GCCGACTTCTTGACGTCGTTGAAGAGTCAGTACCCTGCGGATTCTGTCACTACTAACCCACCCATTGGAGCCCCGATCGACCTCGACCGGGTTTGAGCAACCCAGTTCCACTCGCAGTAT
TTCCAGAACATTATCGACAGGGAGGGCTTGCTTACATCCGACAAAAGTCATCTGGACGATTCCAGAACCAGTCAAGCCGTATACAAGAACAAAGGGAATTTCTTCAATTGGGAATTCGGA
TGGGCCATGCAAGCCATGGCTGGAATCGGTTTACTCACTGGCGATGAAGGNCAAATCCGCACCAATTGTCGGGCTCTTAACCC

Retrieve as FASTA